KEGG   Burkholderia mallei 6: DM78_1761Help
Entry
DM78_1761         CDS       T03489                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmae  Burkholderia mallei 6
Pathway
bmae00071  Fatty acid degradation
bmae00072  Synthesis and degradation of ketone bodies
bmae00280  Valine, leucine and isoleucine degradation
bmae00310  Lysine degradation
bmae00362  Benzoate degradation
bmae00380  Tryptophan metabolism
bmae00620  Pyruvate metabolism
bmae00630  Glyoxylate and dicarboxylate metabolism
bmae00640  Propanoate metabolism
bmae00650  Butanoate metabolism
bmae00900  Terpenoid backbone biosynthesis
bmae01100  Metabolic pathways
bmae01110  Biosynthesis of secondary metabolites
bmae01120  Microbial metabolism in diverse environments
bmae01130  Biosynthesis of antibiotics
bmae01200  Carbon metabolism
bmae01212  Fatty acid metabolism
bmae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM78_1761
   00630 Glyoxylate and dicarboxylate metabolism
    DM78_1761
   00640 Propanoate metabolism
    DM78_1761
   00650 Butanoate metabolism
    DM78_1761
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM78_1761
   00072 Synthesis and degradation of ketone bodies
    DM78_1761
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM78_1761
   00310 Lysine degradation
    DM78_1761
   00380 Tryptophan metabolism
    DM78_1761
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM78_1761
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM78_1761
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM78_1761
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmae04147]
    DM78_1761
Enzymes [BR:bmae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM78_1761
Exosome [BR:bmae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM78_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIO58663
UniProt: A0A290Y978
Position
1:complement(1937108..1938286)
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTGLAKSWRGAFNMTHGATLGGHVVAAAVERAKLDPARVEDVLIGCANPE
GATGANIARQIALRAGLPVGVPGMTVNRFCSSGLQTIALAAQRVIAGEGDVFVAGGVESI
SCVQNEMNRHMLREGWLDAHKPEIYWTMLQTAENVAKRYGISKARQDEYGVNSQLRAAAA
QAAGRFNAEIVPITVRAGVADKATGRLYTKEVTLAADEGIRPDTTLEGVAKIRAALPGGV
ITAGNASQFSDGAAACVVMNAKVAEREGLAPLGIFRGFAVAGCEPDEMGIGPVYAVPKLL
KQAGLKVSDIDLWELNEAFAVQVLYCRDTLGIPDDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGAKYVVVTMCIGGGQGAAGLFEVV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcccgcaccgggctcgcgaaatcctggcgcggc
gcgttcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggcggccgtcgag
cgcgcgaagctcgatcccgcgcgcgtcgaggacgtgctgatcggctgcgcgaacccggaa
ggcgcgacgggcgcgaacatcgcgcggcagatcgcgctgcgcgcggggctgcccgtcggc
gtgccggggatgaccgtcaaccgcttctgctcgtcgggattgcagacgatcgcgctcgcc
gcgcagcgcgtgatcgcgggcgagggcgacgtgttcgtcgcgggcggcgtcgaatcgatc
tcgtgcgtgcagaacgagatgaaccgccacatgctgcgcgagggctggctcgacgcgcac
aagccggagatctactggacgatgctgcagacggccgagaacgtcgcgaagcgttacggc
atctcgaaggcgcgccaggacgagtacggcgtgaattcgcagctgcgcgcggccgccgcg
caggcggcggggcgctttaacgccgagatcgtgccgatcaccgtgcgcgcgggcgtcgcc
gacaaggcgacgggccgcctctacacgaaggaggtgacgctcgccgccgacgagggcatt
cggcccgacacgacgctcgagggcgtcgcgaagatccgcgcggcgctgccgggcggcgtg
atcaccgcgggcaacgcgagccagttctcggacggcgcggccgcgtgcgtcgtgatgaac
gcgaaggtggccgagcgcgagggcctcgcgccgctcggcattttccgcggcttcgcggtg
gccggctgcgagccggacgagatgggcatcgggcccgtctacgcggtgccgaagctgctg
aagcaggcggggctcaaggtgtccgacatcgatctgtgggaactgaacgaggcgttcgcg
gtgcaggtgctctattgccgcgacacgctcgggattcccgacgatcggctgaacgtgaac
ggcggcgcgatcgcggtcggccatccgtacggcgtatcgggcgcgcggctcaccggccac
gcgctgatcgagggcaagcggcgcggcgcgaaatacgtcgtcgtgacgatgtgcatcggc
ggcgggcagggcgcggcggggctgttcgaggtggtgtga

DBGET integrated database retrieval system