KEGG   Burkholderia mallei 6: DM78_3175Help
Entry
DM78_3175         CDS       T03489                                 

Definition
(GenBank) phosphoesterase family protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bmae  Burkholderia mallei 6
Pathway
bmae00562  Inositol phosphate metabolism
bmae00564  Glycerophospholipid metabolism
bmae01100  Metabolic pathways
bmae01110  Biosynthesis of secondary metabolites
bmae02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DM78_3175
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DM78_3175
   00565 Ether lipid metabolism
    DM78_3175
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DM78_3175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bmae02042]
    DM78_3175
Enzymes [BR:bmae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     DM78_3175
Bacterial toxins [BR:bmae02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   DM78_3175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase ENOD93
Motif
Other DBs
NCBI-ProteinID: AIO56772
UniProt: A0A3N4FQI2
Position
2:complement(11349..13016)
Genome map
AA seq 555 aa AA seqDB search
MFRRAWIATACAGSAIALYACGGTDSNAPVTSQNALRTATPIKHLVVIYGENVSFDHYFG
TYPNAANPPGEPAFSAASGTPSINGLSGLLLTANPNATNPANGAGASNPFRLDRTQAATA
DQNHAYTAEEQAYDNGLADLFPKYTGNGSSGGAGAFGTTGQVMGYFDGNTVTALWNYAQR
FAMSDNAYTSTYGPSTPGALNVIAGQTDGMQIVKTSKAVSTLAKTSYYINDGQGGLTMIN
DVDPGYDVCSSTTDQAMMSGKNIGDLLNARNVTWGGFMGGFNLSTTNANGTTGCKRSTIA
TAVNAATTDYIPHHNWFQYYASTANPQHTRPSSIAAIGSSVQTDGKTPEPANHQYDSDDF
FAAVKAGNFPSVSFLKAPATQDAHAGYSDPLDEQQFVTKVVNFLQQQPDWASTAVIVTYD
DSDGWYDHAYTAPTRASFDAVDQLNGNGACGSGAATTGINGAAVNGRCGPGTRIPFVVVS
PWAKQNYVSHTLIDQASVVRFIEDNWLGGQRIGGGSFDATAGNMRDLFDFSGAVNKTPLY
LDPTLGTKLATAPSI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcgagcctggatcgccaccgcgtgcgccggatcggccatcgccctctatgcg
tgcggcggcaccgacagcaacgcgcccgtcacgtcgcaaaacgcattgcggaccgcgacg
ccgatcaagcatctcgtcgtgatctacggcgagaacgtgtcgttcgaccactacttcggc
acctacccgaacgccgcgaacccgccgggcgagccggcgttcagcgccgcgtcgggcacg
ccgtcgatcaacggcctgtcgggcctgctgctcaccgcgaacccgaacgcgacgaatccg
gcgaacggcgcgggcgcgagcaatccgttccgcctcgaccgcacacaggccgcgacggcc
gatcagaaccacgcgtacaccgccgaggagcaggcgtacgacaacggcctcgccgatctc
ttcccgaaatacacgggcaacggctcgagcggcggcgcgggcgcgttcggcacgaccggc
caggtgatgggttacttcgacggcaacacggtgaccgcgctgtggaactacgcgcagcgc
ttcgcgatgagcgacaacgcatacacgtcgacctacggcccgtcgacgccgggcgcgctg
aacgtgatcgccggccagaccgacgggatgcagatcgtgaagacgtcgaaggccgtgtcg
acgctcgcgaagacgtcgtactacatcaacgacggccagggcggcctcacgatgatcaac
gatgtcgaccccggctacgacgtgtgctcgagcacgaccgatcaggcgatgatgtccggc
aagaacatcggcgatctgctgaacgcgcgcaacgtcacgtggggcggcttcatgggcggc
ttcaatctgtcgacgacgaacgcgaacggcacgacgggctgcaagcgcagcacgatcgcg
accgcggtgaacgcggcgacgaccgactacatcccgcaccacaactggttccagtactac
gcgtcgaccgcgaacccgcagcacacgcgcccgagctcgatcgcggcgatcggctcgagc
gtccagacggacggcaagacgcccgagcccgcgaatcaccagtacgattcggacgacttc
ttcgcggccgtgaaggcgggcaacttcccgtcggtcagcttcctgaaggcgcccgccacg
caagacgcgcacgccggctactcggatccgctcgacgagcagcagttcgtgacgaaggtc
gtcaacttcctgcagcagcagcccgactgggcgagcaccgcggtgatcgtcacgtatgac
gactcggacggctggtacgaccatgcgtacaccgcgccgacgcgcgcgtcgttcgatgcg
gtcgaccaactgaacggcaacggcgcgtgcggctccggcgccgcgacgacgggcatcaac
ggcgccgccgtcaacggccgctgcggtcccggcacgcggattccgttcgtcgtcgtgtcg
ccgtgggcgaagcagaactacgtgagccacacgctgatcgatcaggcgtcggtcgtgcgc
ttcatcgaggacaactggctcggcggccagcggatcggcggcggctcgttcgatgcgacc
gcgggcaacatgcgcgatctgttcgatttctcgggcgcggtgaacaagacgccgttgtac
ctcgatccgacgctcggcacgaagctcgcaaccgcgccttcgatctga

DBGET integrated database retrieval system