KEGG   Burkholderia mallei 6: DM78_321Help
Entry
DM78_321          CDS       T03489                                 

Gene name
sucD
Definition
(GenBank) succinate-CoA ligase, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
bmae  Burkholderia mallei 6
Pathway
bmae00020  Citrate cycle (TCA cycle)
bmae00640  Propanoate metabolism
bmae00660  C5-Branched dibasic acid metabolism
bmae01100  Metabolic pathways
bmae01110  Biosynthesis of secondary metabolites
bmae01120  Microbial metabolism in diverse environments
bmae01130  Biosynthesis of antibiotics
bmae01200  Carbon metabolism
Module
bmae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM78_321 (sucD)
   00640 Propanoate metabolism
    DM78_321 (sucD)
   00660 C5-Branched dibasic acid metabolism
    DM78_321 (sucD)
Enzymes [BR:bmae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DM78_321 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig DUF1611_N
Motif
Other DBs
NCBI-ProteinID: AIO59774
UniProt: A0A3N4FVH9
Position
1:complement(352411..353292)
Genome map
AA seq 293 aa AA seqDB search
MSILINKDTKVITQGITGKTGQFHTRACREYANGREAFVAGVNPKKAGDNFEGIPIYASV
KEAKAETGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIPVRDMIEVKDRMRREGR
KTLLLGPNCPGTITPDELKIGIMPGHIHRKGRIGVVSRSGTLTYEAVAQLTALGLGQSSA
VGIGGDPINGLKHIDVMKMFNDDPDTDAVVMIGEIGGPDEANAAQWIKDNMKKPVVGFIA
GVTAPPGKRMGHAGALISGGADTAEAKLEIMEACGITVTRNPSEMGRLLKAAL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattctgatcaacaaagacacgaaggtcatcacgcagggcatcaccggcaagacc
ggccagttccacacgcgcgcctgccgtgaatatgcaaacggccgcgaagcgttcgtcgcg
ggcgtgaacccgaagaaggccggcgataatttcgaaggcattccgatctacgcgagcgtc
aaggaagcgaaggcggaaaccggcgcgaccgtgtcggtcatctacgtgccgccggcgggc
gccgccgcggcgatctgggaagcggtcgaagccgatctcgatctcgcgatctgcatcacg
gaaggcattcccgttcgcgacatgatcgaagtgaaggaccgcatgcgccgcgaaggccgc
aagacgctgctgctcgggccgaactgcccgggcacgatcacgccggacgaactgaagatc
ggcatcatgccgggccacatccaccgcaagggtcgtatcggcgtcgtgtcgcgctcgggc
acgctgacgtatgaagccgtcgcgcaactgacggcgctcggcctcggccagtcgtcggcg
gtcggcatcggcggcgatccgatcaacggtctgaagcacatcgacgtgatgaagatgttc
aacgacgatccggacacggatgccgtcgtgatgatcggcgaaatcggcggcccggacgaa
gcgaacgccgctcagtggatcaaggacaacatgaagaagcccgtcgtcggcttcatcgcg
ggcgtcacggcgcctccgggcaagcgcatgggccacgccggcgcgctgatctcgggcggt
gcggatacggccgaagcgaagctggaaatcatggaagcgtgcggcatcacggtcacgcgc
aatccgtcggagatgggccgcctgctgaaggcagcgctgtaa

DBGET integrated database retrieval system