KEGG   Burkholderia mallei FMH 23344: DM51_2261Help
Entry
DM51_2261         CDS       T03523                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DM51_2261 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bmaf03011]
    DM51_2261 (rplV)
Ribosome [BR:bmaf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DM51_2261 (rplV)
  Bacteria
    DM51_2261 (rplV)
  Archaea
    DM51_2261 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AIP77436
UniProt: A0A3N4FVI7
Position
1:complement(2519173..2519502)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaagacgcgccttgtg
gctgaccagatccgcggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggctggcatcgtgaagaaggtcgtgctgtcggcgatcgcgaatgcggagcac
aacgaaggcgccgacatcgacgagctcaagatcaagagcatctacgtcgacaaggctgca
tcgctcaagcgtttcaccgcgcgcgcaaagggccgcggcaaccgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system