KEGG   Burkholderia mallei FMH 23344: DM51_3077Help
Entry
DM51_3077         CDS       T03523                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00071  Fatty acid degradation
bmaf00072  Synthesis and degradation of ketone bodies
bmaf00280  Valine, leucine and isoleucine degradation
bmaf00310  Lysine degradation
bmaf00362  Benzoate degradation
bmaf00380  Tryptophan metabolism
bmaf00620  Pyruvate metabolism
bmaf00630  Glyoxylate and dicarboxylate metabolism
bmaf00640  Propanoate metabolism
bmaf00650  Butanoate metabolism
bmaf00900  Terpenoid backbone biosynthesis
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
bmaf01120  Microbial metabolism in diverse environments
bmaf01130  Biosynthesis of antibiotics
bmaf01200  Carbon metabolism
bmaf01212  Fatty acid metabolism
bmaf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM51_3077
   00630 Glyoxylate and dicarboxylate metabolism
    DM51_3077
   00640 Propanoate metabolism
    DM51_3077
   00650 Butanoate metabolism
    DM51_3077
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM51_3077
   00072 Synthesis and degradation of ketone bodies
    DM51_3077
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM51_3077
   00310 Lysine degradation
    DM51_3077
   00380 Tryptophan metabolism
    DM51_3077
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM51_3077
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM51_3077
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM51_3077
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmaf04147]
    DM51_3077
Enzymes [BR:bmaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM51_3077
Exosome [BR:bmaf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM51_3077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIP75728
UniProt: A0A290Y639
Position
1:3411049..3412242
Genome map
AA seq 397 aa AA seqDB search
MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALERAGLQPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAHDMLVAGSVDVIVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFSRDA
QDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGA
RILVTLIGALRARGAKRGVASLCIGGGEATAMGIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgatcaggatccgatcgtcatcgcatcggcggcgcgcacgccgatcgcg
ggctttcagggcgagttcgcgtcgctcgccgcaccgcagctgggcgcggccgcgatcgcc
gcggcgctcgagcgcgcgggcctgcaaccggagcagatcgacgaggcggtgatgggctgc
gtgctgcccgccgggcaggggcaggcgccggcgcggcaggcggcgctcggcgcgaagctg
ccgctgtcggtcggctgcacgacgatcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgctcgtggcgggctccgtcgacgtgatcgtcgcgggcggcatg
gaaagcatgacgaacgcgccgtacctgctgccgaaggcgcgcgccggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctcgaggacgcctacgacaagggc
cggctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttctcgcgcgacgcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcgtgggaaatcgcgcccgtgacggtggccggcaagaagggcgatgcggtgatcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagattccgacgctcaagcccgcgttc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaaccggctcgggctcgcgccgctcgcgcgcgtc
gtcggccattcgacgttcgcgcaggcgccgtcgaagttcacgacggcgcctgtcggcgcg
atccggcgcctgttcgagaagaacggctggcgcgcggccgaggtcgacctgtacgagatc
aacgaagcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgag
aaggtcaacgtgaacggcggcgcgtgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggcgcgctgcgcgcgcgcggggccaagcgcggcgtggcg
agcctgtgcatcggcggcggcgaagcgaccgcgatgggcatcgagctgatctga

DBGET integrated database retrieval system