KEGG   Burkholderia mallei FMH 23344: DM51_3675Help
Entry
DM51_3675         CDS       T03523                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00564  Glycerophospholipid metabolism
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
Module
bmaf_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DM51_3675
Enzymes [BR:bmaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     DM51_3675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PSDC Metal_resist
Motif
Other DBs
NCBI-ProteinID: AIP73673
UniProt: A0A3N4FH00
Position
2:complement(601547..602848)
Genome map
AA seq 433 aa AA seqDB search
MTNRTNATHATNATNATNAAREASAERRRLGGWLPAEEAALARYRKTLAAHAREHADGAP
MTEAVRELAALAEGEPPLRMALTRAIDEARSRGYELGYETIGELMTVIDFVMTYAPPFSE
SGLVVCPLNALLDWPLCMPSGYAFFRDRAVNAQLKRVLNVWCGFLGGPHSRAHLNASEPD
GWFSAEAVKRIGMSQFHCDPQLPYWGFASWNDFFTRRFLPDARPVAAPDDPAVIVSACEA
APYHVAHDLKLLDTFWIKSQPYSLRDIFTAARGELARGFVGGSLYQAFLSAYDYHRWHAP
VAGRIAHAYLVDGTYYSSTEAEGADPAGLNDSQGYMTAVATRAVIVIDADAPEIGRVACV
FVGMGEVSSCMIDALPGQHVEKGEEIGYFQYGGSTYCMLFEPGVIGSFVAHPRYHEGAPA
VQVNAEVAAVAAK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccgaacgaacgcaacccacgcgacgaacgcgacgaacgcgacaaatgccgcc
cgtgaggcgtccgccgagcgccgacgcctaggcggatggctgcccgccgaggaggcggcg
ctcgcgcgctatcggaagacgctcgccgcgcatgcgcgcgagcacgcggacggcgcgccg
atgacggaggcggtgcgcgagctcgcggcgctcgccgaaggcgagccgccgctgcgcatg
gcgctgacgcgcgcgatcgacgaggcgcgctcgcgcggctacgagctcggctacgagacg
atcggcgaactgatgacggtgatcgatttcgtgatgacgtacgcgccgccgttcagcgaa
tccgggctcgtggtctgcccgctgaacgcgctgctcgactggccgctttgcatgccgtcc
ggctacgcgttctttcgcgaccgcgcggtgaacgcgcaactcaagcgcgtgctgaacgta
tggtgcggctttctgggcggcccgcattcgcgcgcgcacctgaacgcgtcggagccggac
ggctggttcagcgcggaggccgtgaagcggatcggcatgtcgcagttccattgcgatccg
caactgccttactggggcttcgcctcgtggaacgatttcttcacgcggcgctttctgccc
gacgcgcggcccgtcgcggcgccggacgatccggccgtgatcgtcagcgcatgcgaggcc
gcgccgtatcacgtcgcgcacgatctgaagctgctcgacacgttctggatcaagtcgcag
ccgtattcgctgcgcgacatcttcaccgcggcgcgcggcgagctcgcgcgcggcttcgtc
ggcggctcgctgtaccaggcgttcctgagcgcctacgattatcaccgctggcatgcgccc
gtcgcggggcgcatcgcgcacgcgtatctcgtcgacggcacctactattcgagcaccgag
gccgaaggcgcggacccggccgggctcaacgattcgcagggctacatgacggccgtcgcg
acgcgcgcggtgatcgtcatcgatgccgatgcgccggagatcggccgcgtcgcatgcgtg
ttcgtcgggatgggcgaagtgtcgtcgtgcatgatcgacgcgctgcccgggcagcatgtc
gagaagggcgaggaaatcggctacttccagtacggcggctcgacatactgcatgctcttc
gagccgggcgtgatcggcagcttcgtcgcgcatccgcgttatcacgaaggcgcgccggcc
gtgcaggtgaacgcggaagtggcggccgtcgcggcgaagtga

DBGET integrated database retrieval system