KEGG   Burkholderia mallei FMH 23344: DM51_4061Help
Entry
DM51_4061         CDS       T03523                                 

Definition
(GenBank) polyprenyl synthetase family protein
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00900  Terpenoid backbone biosynthesis
bmaf01100  Metabolic pathways
bmaf01110  Biosynthesis of secondary metabolites
bmaf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM51_4061
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bmaf01006]
    DM51_4061
Enzymes [BR:bmaf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     DM51_4061
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     DM51_4061
Prenyltransferases [BR:bmaf01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   DM51_4061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AIP73926
UniProt: A0A3N4FVQ9
Position
2:1054978..1055862
Genome map
AA seq 294 aa AA seqDB search
MTFDQWMRSVLERVETALGHYLPAGTVAPAQLHEAMRYAVLGGGKRVRPLLCHAAGELTG
ASEAARDAASAALEMIHVYSLVHDDMPCMDDDALRRGKPTVHVKYDEPTALLVGDALQSQ
AFVALTDAAALPADRQAALVRELALASGSIGMAGGQAIDLASVGVALTRDALEKMHRMKT
GALLRASVRMGALAGETPSGDAMRALDAYAAAVGLAFQVVDDILDVTTDSATLGKTAGKD
AANDKPTYVSIIGLDASRALAAQLRADAHAALEPFGARAQRLAELADLVVNRVS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgaccaatggatgcgctcggtgctcgagcgtgtcgagacggccctcggccat
tatttaccggccgggactgtggcgcccgcgcaactgcacgaagcgatgcgctatgcggtg
ctcgggggcggcaaacgcgtgcgtccgctgctgtgccatgcggcgggcgagctcacgggc
gcgtcggaggcggcgcgtgacgcggcgtcggctgcgctcgagatgattcacgtgtattcg
ctcgtgcatgatgatatgccgtgcatggatgacgacgcgctgcgtcgcggcaagccgacc
gtccacgtcaagtacgacgagccgaccgcgctgctcgtcggcgacgcgctgcagtcgcag
gctttcgtcgcgctgaccgacgccgccgcgctgccggccgaccggcaggcggcgctcgtg
cgcgagctcgcgctcgcgagcggctcgatcggcatggcgggcggccaggcgatcgatctc
gcgagcgtcggcgtggcgctcacgcgcgacgcgctggagaagatgcatcggatgaagacg
ggcgcgctgttgcgcgcgtcggtgcgcatgggcgcgcttgcgggcgagacgccgtccggc
gacgcgatgcgcgcgctcgacgcctatgcggcggccgtcggcctggcgttccaggtggtg
gacgacattctcgacgtcaccaccgattccgcgacgctcggcaagacggccggcaaggac
gctgcgaacgacaagccgacctacgtgtcgatcatcggtctcgacgcgtcgcgcgcgctt
gccgcgcaattgcgcgccgatgcgcacgccgcgctcgagccgttcggcgcgcgcgcgcag
cgcctggccgaactggcggacctggtggtgaaccgggtcagctga

DBGET integrated database retrieval system