KEGG   Burkholderia mallei FMH 23344: DM51_4398Help
Entry
DM51_4398         CDS       T03523                                 

Definition
(GenBank) cys/Met metabolism PLP-dependent enzyme family protein
  KO
K04127  isopenicillin-N epimerase [EC:5.1.1.17]
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf00311  Penicillin and cephalosporin biosynthesis
bmaf01100  Metabolic pathways
bmaf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    DM51_4398
Enzymes [BR:bmaf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.17  isopenicillin-N epimerase
     DM51_4398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 SPOR Tcell_CD4_C
Motif
Other DBs
NCBI-ProteinID: AIP74027
UniProt: A0A3N4FQX6
Position
2:1445335..1446492
Genome map
AA seq 385 aa AA seqDB search
MTAPLKSLFLLDPSVTYLNHGAYGATPRPVFERHVQWQYELEREPVDFLSRRFAERMAQA
RAILAEYVDTERDNLVYVSNGTTGVNIVARSLPLGPGDELLTTDHEHGGIERLWRFTAQK
RGFEIVRHKVSLPVTTHARFVEDFWRDVTPRTRAILISQLTSPTALVFPVAAICARARAR
GILTIVDGSHVPGQLPLSLREMDPDFYVGILHKWVCAPKGSAFLYARPDVQPLVEPLVVS
WGWEPKNPGPSKFVEYHEWQGSRDISAFLSVPSAIAFQREHDWDGVRKRCIALASDAQRE
VAALTREPLYHPPGAHEWHGQMVCAQLPPQTDDIALLARLRNECGIDVSVDRFGGRPRIR
VSIQGYNGPDDVDRLLGSLKQLLRL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacagccccactgaaatcgttgtttcttctcgacccgagcgtgacctatctgaaccac
ggcgcgtacggcgcgacgccgcgcccggtgttcgagcgccacgtgcagtggcagtacgag
ctcgaacgcgagccggtcgatttcctgtcgcgccgcttcgccgaacgcatggcgcaggcg
agggcgatactggccgaatacgtggataccgaacgcgacaatctagtatatgtgagcaac
ggcaccacgggcgtgaacatcgtcgcgcgcagcctcccgctcggcccgggcgacgaactg
ctcaccaccgatcacgagcacggcggcatcgagcggctgtggcgcttcaccgcgcaaaag
cgcgggttcgagatcgtccggcacaaggtgtcgctgccggtgacgacgcatgcccggttc
gtcgaggatttctggcgcgacgtgacgccgcgcacgcgcgcgatcctgatcagccagctg
acgtcgcccaccgcgctcgtgtttccggttgcggcgatctgcgcgcgcgcgcgggcgcgc
ggcatcctgacgatcgtcgacggctcgcacgtgcccgggcaactgccgctgtcgctgcgc
gagatggatccggatttttatgtcggcatcctgcataaatgggtgtgcgcgccgaagggc
agcgcgttcctgtatgcgaggccggacgtgcagccgcttgtcgagccgctcgtcgttagt
tggggctgggagccgaagaacccggggccgtcgaagttcgtcgagtatcacgagtggcag
ggcagccgcgacatctccgcgttcctgagcgtgccgagcgcgatcgcgtttcagcgcgag
cacgactgggacggcgtgcgcaagcgctgcatcgcgctcgcgagcgacgcgcagcgcgaa
gtggccgcgttgacgcgcgagccgctctaccatccgccgggcgcgcacgagtggcacggc
cagatggtctgcgcgcaactgccgccgcagacggacgacatcgcgctgcttgcccgcttg
cgcaacgaatgcgggatcgacgtctcggtcgaccgtttcggcggccggcctcgcatccga
gtgtcgattcagggctataacggcccggacgacgtcgatcgattgctcggcagtctgaag
caactgctgcggctttga

DBGET integrated database retrieval system