KEGG   Burkholderia mallei FMH 23344: DM51_4430
Entry
DM51_4430         CDS       T03523                                 

Definition
(GenBank) type IV/VI secretion system , DotU family domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bmaf  Burkholderia mallei FMH 23344
Pathway
bmaf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmaf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DM51_4430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmaf02044]
    DM51_4430
Secretion system [BR:bmaf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DM51_4430
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AIP73572
UniProt: A5PM28
Position
2:complement(1482129..1482794)
AA seq 221 aa
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAV
CAWIDEALLNSGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCL
RLGFRGRYGYDGGDGPLDAIRQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKART
RRRIARAGLSVGLPLAILLSLYLIYHVVIVRMVDAVYPRLQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaagctgaccgattcgatgatgccgctcgtcgcgtatgcgcggcagctcgcgcaatcg
ccgcgcggcgacgccgccgaagtcgcgctgcggctcgacatcctgatcgagcgcgcgcgc
gaccacgcggcgtgcgcgggcgcacccgcggccgacgtcgacgacgcgctgttcgcggtg
tgcgcgtggatcgacgaggcgctgctgaacagcggctgggacgatgccgatcgctggacg
ctgcggctgctgcaaaagcgctacttcgatacgtcgcacgcgggcgtcgtgttcttcgaa
cgcctcggcacgctcgacggcgcgcgcgcgagcgtgctcgaggtctacctgctgtgcctg
cggctcggctttcgcggccgctacggctacgacggcggcgacggcccgctcgacgcgatc
cgccagcgcgcgctcgatgcactgtcggcgcacgcgccgccgtgcgccgcgggcgagccg
ccgtttcccgccgcctatgcgcacgccggcccgcacgccgccgccgcgaaagcgcgcacg
cgccgccggatcgcgcgcgcggggctgagcgtcgggctgccgctcgccatcctgctgtcg
ctctatctgatctatcacgtcgtcatcgtgcggatggtcgacgcggtgtaccccaggctg
caatga

DBGET integrated database retrieval system