KEGG   Burkholderia mallei 2000031063: DM57_11940
Entry
DM57_11940        CDS       T03522                                 

Definition
(GenBank) type VI secretion system protein ImpK
  KO
K11892  type VI secretion system protein ImpK
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DM57_11940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmai02044]
    DM57_11940
Secretion system [BR:bmai02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DM57_11940
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AIW48665
UniProt: A5PM28
Position
2:1675099..1675764
AA seq 221 aa
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAV
CAWIDEALLNSGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCL
RLGFRGRYGYDGGDGPLDAIRQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKART
RRRIARAGLSVGLPLAILLSLYLIYHVVIVRMVDAVYPRLQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaagctgaccgattcgatgatgccgctcgtcgcgtatgcgcggcagctcgcgcaatcg
ccgcgcggcgacgccgccgaagtcgcgctgcggctcgacatcctgatcgagcgcgcgcgc
gaccacgcggcgtgcgcgggcgcacccgcggccgacgtcgacgacgcgctgttcgcggtg
tgcgcgtggatcgacgaggcgctgctgaacagcggctgggacgatgccgatcgctggacg
ctgcggctgctgcaaaagcgctacttcgatacgtcgcacgcgggcgtcgtgttcttcgaa
cgcctcggcacgctcgacggcgcgcgcgcgagcgtgctcgaggtctacctgctgtgcctg
cggctcggctttcgcggccgctacggctacgacggcggcgacggcccgctcgacgcgatc
cgccagcgcgcgctcgatgcactgtcggcgcacgcgccgccgtgcgccgcgggcgagccg
ccgtttcccgccgcctatgcgcacgccggcccgcacgccgccgccgcgaaagcgcgcacg
cgccgccggatcgcgcgcgcggggctgagcgtcgggctgccgctcgccatcctgctgtcg
ctctatctgatctatcacgtcgtcatcgtgcggatggtcgacgcggtgtaccccaggctg
caatga

DBGET integrated database retrieval system