KEGG   Burkholderia mallei 2000031063: DM57_13080Help
Entry
DM57_13080        CDS       T03522                                 

Definition
(GenBank) aminopeptidase
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
bmai  Burkholderia mallei 2000031063
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bmai01002]
    DM57_13080
Enzymes [BR:bmai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     DM57_13080
Peptidases and inhibitors [BR:bmai01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   DM57_13080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20 Peptidase_M42 DUF2499
Motif
Other DBs
NCBI-ProteinID: AIW48860
UniProt: A0A3N4FMR3
Position
2:1918247..1919473
Genome map
AA seq 408 aa AA seqDB search
MSKLQHLAAAVCGALCVSAAHAAPVWITLSEPALHELRALDPAVTSRYSAALATGDAKRT
ETIHVAQVDDSLLESLSQAIRRARGHGPGFFVHATFDEARASLQPSAAKQAAAIDYPITY
SQQVRNWISQLQASNIVSTIVSLSGFTNRYYTTTHGVAASDWIAQQWKQLAGSRTDVTVE
QFTHAGWPQKSVILTIKGSDPAAGVVVIGGHLDSTVGRMSENTRAPGADDDASGIASLTE
ALRVLLANRYQPKRTLKFIGYAAEEAGLLGSQAIAKQFRAQNVNVVGAFQLDMTNYKGDP
KDIYLISDYTNATQNTYLANLAKAYLPELAVGTSQCGYACSDHASWNAQGYPASFPFEAD
QNDNPYIHSAYDTLERSDSQGNHALKFSKLALAYAAELGGGLSASAKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagctccaacacctcgccgccgcggtctgcggcgccctctgcgtatcggcggcc
catgccgcgccggtgtggatcacgctctccgagcccgccctgcacgagctgcgcgcgctc
gatcccgccgtgacgagccgttacagcgcggcgctcgccaccggcgacgcgaagcgcacc
gaaacgatccacgtcgcgcaggtcgacgattcgctgctcgaatcgctgtcgcaggcgatc
cgccgcgcgcgcggccacggcccgggctttttcgtgcacgcgacgttcgacgaagcgcgc
gcgtcgctgcagccgagcgcggcgaagcaggcggccgcgatcgattacccgatcacctac
tcgcaacaggtccgcaactggatctcgcaactgcaggcgagcaacatcgtcagcaccatc
gtctcgctgtccggcttcacgaaccgctactacacgacgacgcacggcgtggccgcgtcc
gactggatcgcgcagcaatggaagcagttggccggctcgcgcaccgatgtgacggtcgag
cagttcacgcatgccggctggccgcagaaatcggtgatcctgacgatcaagggcagcgat
ccggccgcgggcgtcgtcgtgatcggcggccatctcgattcgaccgtcggccgcatgagc
gagaacacgcgcgcgcccggcgcggacgatgacgcatccggcatcgcaagcctcaccgag
gcgctgcgcgtgctgctcgcgaaccgctaccagccgaagcgcacgctcaagttcatcggc
tacgcggcggaagaggcgggccttctcggctcgcaggcgatcgcgaagcagttcagggcg
cagaacgtgaacgtcgtcggcgcgttccagctcgacatgacgaactacaagggagatccg
aaggatatctatctgatcagcgactacacgaacgcgacacagaacacgtacctcgcgaac
ctcgcgaaagcgtatctgcccgagctcgcggtcggcacgtcgcaatgcggctatgcgtgc
tccgatcacgcgtcgtggaacgcgcagggctatccggcgtcgttcccgttcgaagcggat
cagaacgacaatccgtacatccattccgcgtatgacacgctcgagcggtcggactcgcaa
ggcaaccacgcgctgaagttcagcaagctcgcgctcgcgtacgcggcggagctgggcggc
gggctgagcgcgtccgcgaagcggtaa

DBGET integrated database retrieval system