KEGG   Burkholderia mallei 2000031063: DM57_271Help
Entry
DM57_271          CDS       T03522                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00071  Fatty acid degradation
bmai00072  Synthesis and degradation of ketone bodies
bmai00280  Valine, leucine and isoleucine degradation
bmai00310  Lysine degradation
bmai00362  Benzoate degradation
bmai00380  Tryptophan metabolism
bmai00620  Pyruvate metabolism
bmai00630  Glyoxylate and dicarboxylate metabolism
bmai00640  Propanoate metabolism
bmai00650  Butanoate metabolism
bmai00900  Terpenoid backbone biosynthesis
bmai01100  Metabolic pathways
bmai01110  Biosynthesis of secondary metabolites
bmai01120  Microbial metabolism in diverse environments
bmai01130  Biosynthesis of antibiotics
bmai01200  Carbon metabolism
bmai01212  Fatty acid metabolism
bmai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM57_271
   00630 Glyoxylate and dicarboxylate metabolism
    DM57_271
   00640 Propanoate metabolism
    DM57_271
   00650 Butanoate metabolism
    DM57_271
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM57_271
   00072 Synthesis and degradation of ketone bodies
    DM57_271
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM57_271
   00310 Lysine degradation
    DM57_271
   00380 Tryptophan metabolism
    DM57_271
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM57_271
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM57_271
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM57_271
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmai04147]
    DM57_271
Enzymes [BR:bmai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM57_271
Exosome [BR:bmai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM57_271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIO81264
UniProt: A0A290Y978
Position
1:3207727..3208905
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTGLAKSWRGAFNMTHGATLGGHVVAAAVERAKLDPARVEDVLIGCANPE
GATGANIARQIALRAGLPVGVPGMTVNRFCSSGLQTIALAAQRVIAGEGDVFVAGGVESI
SCVQNEMNRHMLREGWLDAHKPEIYWTMLQTAENVAKRYGISKARQDEYGVNSQLRAAAA
QAAGRFNAEIVPITVRAGVADKATGRLYTKEVTLAADEGIRPDTTLEGVAKIRAALPGGV
ITAGNASQFSDGAAACVVMNAKVAEREGLAPLGIFRGFAVAGCEPDEMGIGPVYAVPKLL
KQAGLKVSDIDLWELNEAFAVQVLYCRDTLGIPDDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGAKYVVVTMCIGGGQGAAGLFEVV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcccgcaccgggctcgcgaaatcctggcgcggc
gcgttcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggcggccgtcgag
cgcgcgaagctcgatcccgcgcgcgtcgaggacgtgctgatcggctgcgcgaacccggaa
ggcgcgacgggcgcgaacatcgcgcggcagatcgcgctgcgcgcggggctgcccgtcggc
gtgccggggatgaccgtcaaccgcttctgctcgtcgggattgcagacgatcgcgctcgcc
gcgcagcgcgtgatcgcgggcgagggcgacgtgttcgtcgcgggcggcgtcgaatcgatc
tcgtgcgtgcagaacgagatgaaccgccacatgctgcgcgagggctggctcgacgcgcac
aagccggagatctactggacgatgctgcagacggccgagaacgtcgcgaagcgttacggc
atctcgaaggcgcgccaggacgagtacggcgtgaattcgcagctgcgcgcggccgccgcg
caggcggcggggcgctttaacgccgagatcgtgccgatcaccgtgcgcgcgggcgtcgcc
gacaaggcgacgggccgcctctacacgaaggaggtgacgctcgccgccgacgagggcatt
cggcccgacacgacgctcgagggcgtcgcgaagatccgcgcggcgctgccgggcggcgtg
atcaccgcgggcaacgcgagccagttctcggacggcgcggccgcgtgcgtcgtgatgaac
gcgaaggtggccgagcgcgagggcctcgcgccgctcggcattttccgcggcttcgcggtg
gccggctgcgagccggacgagatgggcatcgggcccgtctacgcggtgccgaagctgctg
aagcaggcggggctcaaggtgtccgacatcgatctgtgggaactgaacgaggcgttcgcg
gtgcaggtgctctattgccgcgacacgctcgggattcccgacgatcggctgaacgtgaac
ggcggcgcgatcgcggtcggccatccgtacggcgtatcgggcgcgcggctcaccggccac
gcgctgatcgagggcaagcggcgcggcgcgaaatacgtcgtcgtgacgatgtgcatcggc
ggcgggcagggcgcggcggggctgttcgaggtggtgtga

DBGET integrated database retrieval system