KEGG   Burkholderia mallei 2000031063: DM57_2738Help
Entry
DM57_2738         CDS       T03522                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DM57_2738
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmai02000]
    DM57_2738
Enzymes [BR:bmai01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     DM57_2738
Transporters [BR:bmai02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    DM57_2738
   Histidine transporter
    DM57_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_16 AAA_15 APS_kinase AAA_22 ATPase_2 PRK AAA_33 Zeta_toxin RsgA_GTPase G-alpha RYDR_ITPR AAA_23
Motif
Other DBs
NCBI-ProteinID: AIO81547
Position
1:486468..487247
Genome map
AA seq 259 aa AA seqDB search
MNTQMHKLFVDDLHKRYGNNEVLKGVSLRANAGDVISVIGSSGSGKSTMLRCINFLEQPN
AGRIFVDGEEVRTAQDRTGALKAADSKQLRRVRTKLAMVFQHFNLWAHMNVLENVMEAPV
HVLGITKREAQERAREYLEKVGLAPRVETQYPSHLSGGQQQRVAIARALAMHPDVMLFDE
PTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEEGAPAD
VFGATKSERLRQFLSGSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccagatgcacaagctcttcgtcgacgacctccacaagcgctacggcaacaac
gaagttttgaagggcgtctcgctgcgcgcgaacgcgggcgacgtgatcagcgtgatcggc
tcgtccggctcgggcaagagcacgatgctacgctgcatcaacttcctcgagcagcccaac
gcgggccgcatcttcgtcgacggcgaggaagtgcgcaccgcgcaggacaggacgggcgcg
ctcaaggccgccgattcgaagcagctccggcgcgtgcgcacgaagctcgcgatggtgttc
cagcacttcaatctgtgggcgcacatgaacgtgctggagaacgtgatggaagcgccggtg
catgtgctggggatcacgaagcgcgaggcgcaggagcgcgcgcgcgaatatctagagaag
gtggggctcgcgccgcgggtggagacgcagtatccgtcgcacctgtcgggcggccagcag
cagcgggtcgcgatcgcgcgcgcgctcgcgatgcacccggacgtgatgctgttcgacgag
ccgacgtcggcgctggatccggagctcgtcggcgaagtgctgaaggtgatgcagaaactg
gcggaggaagggcgcacgatgatcgtcgtcacgcacgagatgggcttcgcgcgcaacgtg
tcgaaccacgtgatgttcctgcatcaggggcgcgtcgaggaagaaggcgcgcccgccgac
gtgttcggcgccacgaagagcgagcgcctgagacagttcctgtccggcagcctcaaataa

DBGET integrated database retrieval system