KEGG   Burkholderia mallei 2000031063: DM57_2740Help
Entry
DM57_2740         CDS       T03522                                 

Definition
(GenBank) histidine ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DM57_2740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmai02000]
    DM57_2740
Transporters [BR:bmai02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    DM57_2740
   Histidine transporter
    DM57_2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 ASC
Motif
Other DBs
NCBI-ProteinID: AIO80105
UniProt: A0A3N4FY68
Position
1:485046..485735
Genome map
AA seq 229 aa AA seqDB search
MFLQGYGPLILSGTWQTVKLAVLSLALSFLLGLVGAAAKLSRSRVSNGIGTLYTTLIRGV
PDLVLMLLLFYSLQIWLNQLTDLMNWDQIDIDPFAAGVLVLGFIYGAYFTETFRGAFLSV
PRGQLEAGSAYGMTNWQVFARVMFPQMMRFALPGIGNNWQVLVKSTALVSIIGLADVVKA
SQDAGKGTLRFFFFTLLAGAIYLAITTISNFVLMWLEKRYSTGVRKADL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttcaaggctacggcccgctgatactctccggcacctggcagaccgtcaagctc
gcggtgctgtcgctcgcgctgtcgttcctgctcggcctcgtcggcgcggcggcgaaactg
tcgcgaagccgcgtctcgaacggaatcggcacgctctacacgacgctcattcgcggcgtg
ccggacctcgtgctgatgctgctcctcttctacagcctgcagatctggctgaaccagctc
accgatctgatgaactgggatcagatcgacatcgatccgttcgcggccggcgtgctcgtg
ctcggcttcatctacggcgcgtacttcaccgaaaccttccgcggcgcgttcctgtcggtg
ccgcgcggccagctcgaggcgggcagcgcgtacgggatgacgaactggcaggtgttcgcg
cgcgtcatgttcccgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaatcgacggcgctcgtgtcgatcatcggcctcgccgacgtggtgaaggcg
tcgcaggacgcgggcaagggcacgctgcggttcttcttcttcacgctgctcgccggcgcg
atctatctcgcgatcacgacgatctcgaacttcgtgctgatgtggctcgagaagcgttat
tcgaccggcgtacgcaaggcagacctatga

DBGET integrated database retrieval system