KEGG   Burkholderia mallei 2000031063: DM57_2939Help
Entry
DM57_2939         CDS       T03522                                 

Definition
(GenBank) trans-2-enoyl-CoA reductase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00061  Fatty acid biosynthesis
bmai00650  Butanoate metabolism
bmai01100  Metabolic pathways
bmai01120  Microbial metabolism in diverse environments
bmai01200  Carbon metabolism
bmai01212  Fatty acid metabolism
Module
bmai_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DM57_2939
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DM57_2939
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmai01004]
    DM57_2939
Enzymes [BR:bmai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DM57_2939
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     DM57_2939
Lipid biosynthesis proteins [BR:bmai01004]
 Fatty acid synthase
  Component type
   DM57_2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: AIO80841
UniProt: A0A3N4FSP6
Position
1:264441..265634
Genome map
AA seq 397 aa AA seqDB search
MIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVLVIGASTGYGLAARIA
AAFGVGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQATSVNGDAFSDEIKHK
TIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHAVRLRGIDTDNEAIKETL
LQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTAFTYLGEQVTHDIYWNGSI
GEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARGT
HEGCIEQVDGLLRDSLYSAQPHVDAEGRLRADRLELDPAVQARVLELWDQVTDDNLYTLT
DFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtacgcggcttcatctgcgtcaccacccaccccgccggctgc
gcggcgagcgttcgcgagcagatcgcgtacgtcgcccgccgcggcccgatcgagcgcggc
ccgaagaaggtgctcgtgatcggcgcgtcgacgggctacgggctcgccgcgcgcatcgcc
gccgcgttcggcgtgggcgcggcgacgctcggggtgttcttcgagcgcgcgccggcggac
gcgaagcccggcacggccggctggtacaacagcgcggcgttccacgacgaagcggccgcg
cgcggcctccaggcgacgagcgtcaacggcgacgcgttctccgacgagatcaagcacaag
acgatcgatgcgatccggcgcgatctcgggcaggtggaccttgtcgtctacagcgtcgcc
gcgccgcgcaggacgcatccgaaaacgggcgtcacgcatcagtccacgttgaagccgatc
ggccacgcggtgcggctgcgcggcatcgatacggacaacgaggcgatcaaggaaacgctg
ctgcagccggccacgcccgacgagatcgcggacacggtcgccgtgatgggcggcgaggac
tggcgcatgtggatcgacgcgctcgatgcggcgggagtgcttgccgacggcgcgaagacg
accgcgttcacgtatctgggcgagcaggtcacgcacgacatctactggaacggctcgatc
ggcgaagcgaagaaggatctcgaccgcaccgtgctcgcgctgcgcggcaagctcgccgcg
cgcggcggcgacgcgcgcgtctcggtgctgaaggcggtcgtcacgcaggcgagctccgcg
atcccgatgatgccgctctacctgtcgctgctcttcaaggtgatgaaggcgcgcggcacg
catgaaggctgcatcgagcaggtcgacggcctgttgcgcgacagcctgtacagcgcgcag
ccgcacgtcgacgccgaaggccggctgcgcgcggaccgcctcgagctcgatccggccgtg
caggcgcgcgtgctcgagctgtgggaccaggtgacggacgacaatctgtatacgctcacc
gatttcgccggctacaaggccgaattcctgcgcctgttcggcttcgggatcgacggcgtc
gattacgatgcgcctgtcgagccgaacgtacggattccgaatctgatcgaatga

DBGET integrated database retrieval system