KEGG   Burkholderia mallei 23344: DM55_1175Help
Entry
DM55_1175         CDS       T03323                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal00071  Fatty acid degradation
bmal00072  Synthesis and degradation of ketone bodies
bmal00280  Valine, leucine and isoleucine degradation
bmal00310  Lysine degradation
bmal00362  Benzoate degradation
bmal00380  Tryptophan metabolism
bmal00620  Pyruvate metabolism
bmal00630  Glyoxylate and dicarboxylate metabolism
bmal00640  Propanoate metabolism
bmal00650  Butanoate metabolism
bmal00900  Terpenoid backbone biosynthesis
bmal01100  Metabolic pathways
bmal01110  Biosynthesis of secondary metabolites
bmal01120  Microbial metabolism in diverse environments
bmal01130  Biosynthesis of antibiotics
bmal01200  Carbon metabolism
bmal01212  Fatty acid metabolism
bmal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM55_1175
   00630 Glyoxylate and dicarboxylate metabolism
    DM55_1175
   00640 Propanoate metabolism
    DM55_1175
   00650 Butanoate metabolism
    DM55_1175
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM55_1175
   00072 Synthesis and degradation of ketone bodies
    DM55_1175
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM55_1175
   00310 Lysine degradation
    DM55_1175
   00380 Tryptophan metabolism
    DM55_1175
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM55_1175
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM55_1175
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM55_1175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmal04147]
    DM55_1175
Enzymes [BR:bmal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM55_1175
Exosome [BR:bmal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM55_1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIO51335
Position
1:complement(1287055..1288260)
Genome map
AA seq 401 aa AA seqDB search
MEAYIFDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTRAVDDVVLGCVEPI
GEQGACIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSEMAIGGGVESM
SRVPMGSSGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAAA
QAGWFARSIVPVRDANGLTILDHDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRY
PELERIEHVHHAGNSSGIVDGASAVLIGSLEAGKRAGLAPRARIRSFASIGSEPSIMLTG
PAYAAQKALERAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacattttcgacgccgtgcgcacgccgcgcggcaaaggcaagaaggacggc
agcctgcacggcgtcacgccgctcgcgctcgccgcaaccgcgctgcgcgcgattcgcgac
cgcaacggtctcgacacgcgcgccgtcgacgacgtcgtgctcggctgcgtcgagcccatc
ggcgagcaaggcgcgtgcatcggccgcatcgcggtgcttgcggccggctacgcggaaacc
acggccggcgtgcagatcaaccgcttctgcgcatcgggcctcgaggcgtgcaacatggcc
gccgcgcaggtgatgtccggccagtcggagatggcgatcggcggcggcgtcgagagcatg
tcgcgcgtgccgatgggctcgagcggcggcgcgtggcccgtcgatccggcgatcgcgatt
ccgagctatttcgtgccgcagggcgtatcggccgacacgatcgcgacgaaatggggctac
agccgtgccgatgtcgacgcgtacgccgccgagagccaccgccgcgcgcacgcggcggcg
caggcgggctggttcgcgcgctcgatcgtgccggtgcgcgacgcgaacggcctgacgatc
ctcgatcacgacgagacgatccgcccgcagacgacgcccgagacgctcgcgacgctcaag
ccttcgttcgccgaactgggtgagatgtacggcttcgacgcggtgatccgccagcgctat
ccggagctcgaacgcatcgagcacgtgcaccacgcgggcaacagctcggggatcgtcgac
ggcgcgtcggccgtgctgatcggctcgctcgaggcgggcaagcgcgcgggcctcgcgccg
cgcgcgcgaatccgctcgttcgcgagcatcggctcggagccgtcgatcatgctgacgggg
ccggcctacgcggcgcagaaggcgctcgagcgcgccggcatgcgcgcggccgacatcgat
ctgtacgagctgaacgaagcgttcgcgtcggtcgtgctgcgcttcatggacgcgatggcg
attgcgcacgaccggatcaacgtgaacggcggcgcgatcgcgatgggccatccgctcggc
gcgacgggcgcgatgatcctcggcacgctgctcgacgagctcgagcggcgcggcgcggcc
acgggccttgcaacgctgtgcgtcggcgccggcatgggcacggcgaccatcatcgaacgg
atttga

DBGET integrated database retrieval system