KEGG   Burkholderia mallei 23344: DM55_1386Help
Entry
DM55_1386         CDS       T03323                                 

Gene name
phnH
Definition
(GenBank) phosphonate C-P lyase system protein PhnH
  KO
K06165  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH [EC:2.7.8.37]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal00440  Phosphonate and phosphinate metabolism
bmal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM55_1386 (phnH)
Enzymes [BR:bmal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     DM55_1386 (phnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnH
Motif
Other DBs
NCBI-ProteinID: AIO50493
Position
1:complement(1494024..1494647)
Genome map
AA seq 207 aa AA seqDB search
MIDTRFSLADVAPGFADPVQATQRVFRTLLDAMARPGTPGRIEPIGANGSDAAPAMRVAP
AAFASLLTLCDASTPVFLGAPDAALASALRFHTGAPIAAEPRAACFAYLDDANALPPLQC
FASGAPQTPEHAVTLFVRVASLADGEPRTLRGPGIRDARTIAPAGLPDAFWRERAQFAPR
FPCGIDCYLVCGDMLIGLPRTTIVEAC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatacgcgtttctcgctcgccgatgtcgcgcccggcttcgcggatccggtgcaa
gccacgcagcgcgtgttccgcacgctgctcgacgcgatggcgcgccccggcacgcccggg
cgcatcgagccgatcggcgcgaacggctcggacgccgcgccggcgatgcgcgtcgcgccc
gcggcgttcgcgtcgctgctcacgctgtgcgacgcgtccacgccggtgtttctcggcgcg
ccggacgcggcgctcgcgtcggcgctgcgcttccatacgggcgcgccgatcgccgccgag
ccgcgcgccgcgtgcttcgcctacctcgacgacgcgaacgcgctgccgccgctgcagtgc
ttcgcgagcggcgcgccgcagacgcccgagcatgcggtgacgctgttcgtgcgcgtcgcg
tcgctcgcggacggcgagccgcgcacgctgcgcgggccgggcattcgcgacgcgcgcacg
atcgcgccggcgggcttgcccgatgcattctggcgcgaacgcgcgcaattcgccccgcgc
tttccgtgcggaatcgattgctacctggtgtgcggcgacatgctgatcggcctgccgcgc
acgacgatcgtggaggcatgctga

DBGET integrated database retrieval system