KEGG   Burkholderia mallei 23344: DM55_1560Help
Entry
DM55_1560         CDS       T03323                                 

Gene name
garL
Definition
(GenBank) 5-keto-4-deoxy-D-glucarate aldolase
  KO
K01630  2-dehydro-3-deoxyglucarate aldolase [EC:4.1.2.20]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal00053  Ascorbate and aldarate metabolism
bmal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    DM55_1560 (garL)
Enzymes [BR:bmal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.20  2-dehydro-3-deoxyglucarate aldolase
     DM55_1560 (garL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AIO51565
UniProt: A0A3N4FLI2
Position
1:1693996..1694781
Genome map
AA seq 261 aa AA seqDB search
MSTLTHSLKARLRDGDEPLFGLWLTLASEAATEALAHAGFDWLCIDMEHAPNDSRDVAAQ
LRALAAAHLPSEPVVRVPAREPWFVKRALDAGARTLMFPGVETADEAAHAVRLTRFQAPD
APDGLRGVAGIVRAAAYGMRRDYVQTANAQIATIVQIESARGVDEAERIAATPGVDCVFV
GPADLSASLGHLGDTKHPDVAAALEHVLAAGRRAGVPVGIFAADTAGARQSLEAGFRVVA
LSADVVWLLRATRQALQEVRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgctcacccattccctgaaagcacgtttgcgcgacggcgacgagccgctgttc
ggcctatggctgacgctcgcgagcgaggcggcgaccgaggcgctcgcgcacgccggtttc
gactggctgtgcatcgacatggagcacgcgccgaacgacagccgcgacgtcgccgcgcaa
ctgcgcgcgctcgcggccgcgcatctgccgagcgagcccgtcgtgcgggtgccggcgcgc
gagccgtggttcgtcaagcgggcgctcgacgcgggtgcgcgcacgctgatgttcccgggc
gtcgagacggccgacgaggccgcgcatgcggtgcggctcacgcgctttcaggcgcccgat
gcgccggacgggctgcgcggcgttgcgggcatcgtgcgcgcggccgcttatgggatgcgg
cgcgactacgtgcagacggcgaacgcgcagatcgcgacgatcgtgcagatcgaatcggcg
cgcggcgtcgacgaagccgagcggatcgcggcgacgccgggcgtcgattgcgtattcgtc
gggcccgccgacctgtccgcgagcctcgggcatctcggcgacacgaagcatccggacgtc
gcggccgcgctcgagcacgtgctcgcggccgggcggcgcgccggcgtgccggtcggcatc
ttcgccgcggatacggccggcgcgcgccagtctctcgaagccggattccgcgtggtcgcg
ttgtccgcggacgtcgtgtggctgctgcgcgcgacgcgacaggcgctgcaggaggtgcgg
ggatga

DBGET integrated database retrieval system