KEGG   Burkholderia mallei 23344: DM55_2660Help
Entry
DM55_2660         CDS       T03323                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DM55_2660 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bmal03400]
    DM55_2660 (recB)
Enzymes [BR:bmal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DM55_2660 (recB)
DNA repair and recombination proteins [BR:bmal03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DM55_2660 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C PDDEXK_1 UvrD_C_2 DUF374
Motif
Other DBs
NCBI-ProteinID: AIO53031
UniProt: A0A3N4G3Q4
Position
1:2918054..2921866
Genome map
AA seq 1270 aa AA seqDB search
MSHVAPSGPSASELDVFACPLDGVNQIEASAGTGKTWNICALYVRLLLEKDLGADEILVV
TFTKAATAELHERIRARLAQLAHALDTGDDGGDPFIARLFETTLAPERGLDPQTAAKRVR
RALRAFDQAAIHTIHAFCQRALQEAPFAAAMPFAFEMEADDGALRFELAADFWRTRVEPV
AAAYPAFAEWLVEYGAGPAALDAQLARRLKKPLARLRWDGLHAADDGAESAARAHFDTAA
AIWRDERGVLGTLLADAQPSLNQRSHKPEAVSEALDAWARYFEQASAVAALPRAALKLTQ
SALEKATKKGGATPRHAFFDVAQALEAAVAALEAAQRARWLSLVEQWLDAAPAELAQRKR
TRRVVSFDDLLANLYRALDAHPWLRETLRARYPAALIDEFQDTDPLQFAIFDTIFAPAGP
LFLVGDPKQAIYSFRAADLHTYLAARARASARYTLAVNQRSTPAIVDACNRVFGANPRAF
VLDGLDYEPVRAGSRVRAPLVDATDPLAGAGDFRIWTLPAGDDVLTKRDAQRHAAHACAA
EIARLMRGARERAVTLGGEPLAASGIAVLVQTHRQGSLVKRVLAAWGIGSVELAQASVFA
TIDAEQLERVLAAIDAPGDLRRLRSALASDWFGLDAAALWRLEQGDAEQDGIDAAARGAS
GNGGGARAASAGAPAPSPADADAMGWVERFSRYRLLWRERGFAVMWRTLAGELRIAERLM
AGADGERRVTDVNHLAELTQARASAQPGIAPTLRWLAAQRLEGGGDDAQLRLESDRNLVQ
IVTVHKSKGLEYAIVFCPFLNDGGLREPAGSGLPDAREYHDESGCAVLHYGCDDEAAERA
SREAVREQAAERARLVYVALTRAVYRCYLVAGTYQSSRSTKEARRSVLNWLVAGAGRDFD
AWLKEPPEDAELAERWQALAGGPVTLGALPVPAHREPLAAGHDAQATRAARRATRGLRDA
WRIASFSSLASAIARDESGIARAADDEMRPDHDALAAALGADALEPPDAAAAIAPAPAAA
PRELAEDDILAFPRGAAAGECLHRLLELSNFADASTWPPAALRALHERPVEAELALAERL
PAMMTRLVADLAATELVPGMRLAALDPARRLTEMEFLFPAPALDFNALRRLLAAHGYPDV
ALEAGTLAGFVKGFIDMIVEHDGRFWIVDWKSNHLGTTPEAYGERALDAAMAHHAYHLQA
LLYMVALHRYLRVRMRGYDYDAHIAGYLYVFVRGVRPDWRNGGASAGVHARRPARALIEA
LDALMREGDA
NT seq 3813 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgtcgcgccatccggcccgtcggcgagcgagctcgacgtgttcgcgtgtccg
ctcgacggtgtgaaccagatcgaggcgtccgcgggcaccggcaagacctggaacatctgc
gcgctgtacgtgcgcctgctgctcgaaaaggatctcggcgcggacgagattctcgtcgtc
acgttcacgaaggcggcgacggccgagctgcacgaacggattcgcgcgcgcctcgcgcag
ctcgcgcacgcgctcgacacgggcgacgacggcggcgatccgttcatcgcgcgcctgttc
gagacgacgctcgcgcccgagcgcgggctcgatccgcaaacggcggcgaagcgcgtgcgt
cgcgcgctgcgcgcattcgaccaggcggcgatccacacgatccacgcgttctgccagcgg
gcgctgcaggaagcgccgttcgcggcggcgatgccgttcgcgttcgagatggaagcggac
gacggcgcgctgcgcttcgagctggccgccgatttctggcgcacgcgtgtcgagcccgtc
gcggcggcctatccggcgttcgccgagtggctcgtcgagtacggcgcggggccggcggcg
ctcgacgcgcagctcgcgcggcggctgaagaagccgctggcgcgactgcgctgggacggc
ttgcacgcggccgacgacggcgcggaaagcgccgcgcgcgcgcacttcgatacggcggcc
gcgatctggcgcgacgagcgcggcgtgctcggcacgctgctcgccgacgcgcagccgtcg
ttgaaccagcgctcgcacaagccggaggcggtgagcgaggcgctcgacgcgtgggcgcgt
tatttcgagcaggcgagtgcggtggccgcgttgccgcgcgcggcgctcaagctcacgcag
tccgcgctcgagaaagcgacgaaaaagggcggcgcgacgccgcgccacgcgttcttcgac
gtcgcgcaggcgctcgaggcggctgtcgccgcgctcgaggccgcgcagcgcgcgcgctgg
ctgtcgctcgtcgagcaatggctcgacgcggcgcccgccgagctcgcgcagcgcaagcgc
acgcgccgcgtcgtatcgttcgacgatctgctcgcgaacctgtatcgcgcgctcgacgcg
catccgtggttgcgcgagacgctgcgcgcgcgctatccggccgcgctcatcgacgaattc
caggatacggacccgctgcagttcgcgatcttcgatacgatcttcgcgcccgccggcccg
ctctttctcgtcggcgatccgaagcaggcgatctacagcttccgcgcggcggacctgcac
acgtatctcgccgcgcgcgcgcgggcgtccgcgcgctacacgctcgcggtgaaccagcgc
tcgacgcccgcgatcgtcgatgcgtgcaaccgcgtgttcggcgcgaacccgcgcgcgttc
gtgctcgacgggctcgattacgaaccggtgcgcgcgggctcgcgcgtgcgcgcgccgctt
gtcgacgcgaccgatccgcttgccggcgcgggcgacttccgcatatggacgctgcccgcc
ggcgacgacgtgctgaccaagcgcgacgcgcagcggcacgccgcgcatgcatgcgcggcg
gaaatcgcgcggctgatgcggggcgcgcgcgagcgcgcggtgacgctcggcggcgagccg
ctcgcggcgtccggcatcgcggtgctcgtgcagacgcaccggcagggcagtctcgtgaag
cgcgtgctggccgcatggggaatcggcagcgtcgagctcgcccaggcgtcggtattcgca
acgatcgatgccgagcagctcgagcgcgtgctggccgccatcgacgcgccgggcgacctg
cggcgcctgcgctcggcgctcgcgtccgactggttcgggctcgatgcggcggcgctctgg
cgcctcgagcagggcgatgccgagcaggacggcatcgacgccgccgcccgcggcgcgagc
ggcaacggcggcggcgcgcgcgccgcatcggcgggcgcgcccgcgccgtcgcccgcggac
gccgatgcgatgggctgggtcgagcgcttctcgcgctaccggctgctgtggcgcgagcgc
ggcttcgcggtgatgtggcgcacgctcgccggcgagctgcgcatcgccgagcggctgatg
gcgggggcggacggcgagcggcgcgtgaccgacgtcaatcacctcgccgagctgacgcag
gcgcgcgcgtccgcgcagccgggcatcgcgccgacgctgcgctggcttgccgcgcagcgc
ctcgaaggcggtggggacgacgcgcagttgcggctcgaatccgaccgtaacctcgtgcag
atcgtcaccgttcacaagtcgaaggggctcgaatacgcgatcgtgttctgtccgttcctg
aacgacggcgggctgcgcgagccggccggctccggcctgcccgacgcgcgcgagtaccac
gacgaatcgggctgcgcggtgctgcattacggctgcgacgacgaagcggccgagcgcgcg
tcgcgcgaggcggtgcgcgagcaggcggccgagcgcgcgcggctcgtctacgtcgcgctc
acgcgcgccgtctatcggtgctatctggtcgcgggcacctatcagtcgtcgcgttcgacg
aaggaggcgcggcgcagcgtgctgaactggcttgtcgcgggcgcgggccgcgatttcgat
gcgtggctgaaggagccgcccgaagacgcggagctcgccgagcgctggcaggcgctcgcg
ggcggcccggtgacgctcggcgcgctgccggtgcccgcgcatcgcgagccgctcgcggcc
gggcacgatgcgcaggcgacgcgagccgcgcgacgtgcgacgcgtggcttgcgcgacgca
tggcggatcgcgagcttcagctcgctcgcatcggcgatcgcgcgcgatgagagcggcatc
gcgcgcgcggccgacgacgagatgcgccccgatcatgacgcgcttgccgccgcgctcggc
gcggacgcgctcgagccgccggacgcggccgccgcgatcgcgccggcgcccgccgccgcg
ccgcgcgagctcgccgaagacgacatcctcgcgttcccgcgcggcgcggcggcgggcgaa
tgcctgcaccggctgctcgagctgagcaatttcgccgatgcgtcgacgtggccgcccgcc
gcgctgcgcgcgctgcacgagcgcccggtcgaggcggagctcgcgctggccgagcggctg
cccgcgatgatgacgcggctcgtcgccgatctcgcggcgacggagctcgtgccgggcatg
cgcctcgcggcactcgatccggcgcggcggctcacggaaatggagttcctgtttcccgcg
cccgcgctcgatttcaacgcattgcggcgcttgctcgccgcgcacggctatccggacgtc
gcgctcgaagcgggcacgctggccggattcgtcaaaggattcatcgacatgatcgtcgag
cacgacggccgcttctggatcgtcgactggaaatcgaatcatctcggcacgacgcccgaa
gcatacggcgagcgggcgctcgacgccgcgatggcgcatcacgcgtatcacctgcaggcg
ctgctctatatggtcgcgctgcatcgctatctgcgcgtgcgcatgcgtggctacgactac
gacgcgcacatcgcgggctatctgtacgtgttcgtgcgcggcgtgcgtcccgattggcga
aatggcggcgcgagcgccggcgtgcatgcgcggcggcccgcacgcgcgctgatcgaggcg
ctcgacgcgctgatgcgcgagggggatgcatga

DBGET integrated database retrieval system