KEGG   Burkholderia mallei 23344: DM55_4092Help
Entry
DM55_4092         CDS       T03323                                 

Definition
(GenBank) HAD hydrolase, IA, variant 3 family protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal00361  Chlorocyclohexane and chlorobenzene degradation
bmal00625  Chloroalkane and chloroalkene degradation
bmal01100  Metabolic pathways
bmal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DM55_4092
   00361 Chlorocyclohexane and chlorobenzene degradation
    DM55_4092
Enzymes [BR:bmal01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     DM55_4092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AIO53859
UniProt: A0A3N4FIX1
Position
2:1061334..1061957
Genome map
AA seq 207 aa AA seqDB search
MTVKAVVFDFGGVLIDWSPEYLYRKLIPDEAERRWFLTHVCGMDWVVRQDGGQTIEEGTA
ERIALFPEHEALIRAFYARWHEMIGGELADGAALVDALDARGVPLFGLTNWSAQTFPYAW
ENFPVLRRFRDIVVSGRVKLAKPDPAIYREMHARIEPHLPGIAPHELVFIDDNAKNAAAA
AALGWHGIHHTSAAATRARLRELGALG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaaggcagtcgtattcgatttcggcggcgtgctgatcgactggagccccgag
tatctgtaccggaaactgattcccgatgaagccgagcggcgctggtttctcacgcacgta
tgcggaatggactgggtggtgaggcaggacggcggccagacgatcgaggaggggaccgcc
gagcgtatcgcgctgtttcccgagcatgaggcgctgatccgcgcgttctacgcgcggtgg
cacgagatgatcggcggcgagctcgcggacggcgccgcgctcgtcgacgcgctcgatgcg
cgcggtgtgccgctcttcgggctcacgaactggtccgcgcagacgtttccgtatgcgtgg
gagaacttccccgtgctgcggcgtttcagggacatcgtcgtgtccggccgcgtgaagctc
gcgaagcccgatccggcgatctaccgcgagatgcacgcgcggatcgaaccgcatctgccg
ggcatcgcgccgcacgagctcgttttcatcgacgacaacgcgaagaacgcggcggccgcg
gccgcgctcggctggcacgggattcatcacacgagcgccgcggcgacgcgggcgcggctg
cgcgagctgggcgcgcttggctga

DBGET integrated database retrieval system