KEGG   Burkholderia mallei 23344: DM55_4276Help
Entry
DM55_4276         CDS       T03323                                 

Definition
(GenBank) amino ABC transporter, permease , 3-TM region, His/Glu/Gln/Arg/opine family domain protein
  KO
K10016  histidine transport system permease protein
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DM55_4276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmal02000]
    DM55_4276
Transporters [BR:bmal02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    DM55_4276
   Histidine transporter
    DM55_4276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AIO53671
UniProt: A0A3N4FRN8
Position
2:1264564..1265253
Genome map
AA seq 229 aa AA seqDB search
MLFQGFGPLLWAGTIETVKLAVLSLAASLVLGLAGAAAKLSSNRALASVGTFYTTLIRAV
PDLVLMLLLFYGIQILLNDVTDMLGAEQIDIDPFVAGIVTLGFIYGAYFTETFRGAFLAV
PRGQLEAGFAYGMGAWRVFARIMFAQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTLNFFFFTLAAGAIYLAITTLSNLVLMYLEKRYSAGVRRVAL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctctttcaaggcttcggcccgctgctctgggccggcacgatcgagacggtcaagctc
gccgtgctttcgctcgccgcgtcgctcgtgctcgggcttgccggcgcggccgccaagctg
tcgtccaatcgcgcgttggcgagcgtcggcacgttctacacgacgctgattcgtgcggtg
ccggacctcgtgctgatgctgctgctgttctacggcatccagatcctgctgaacgacgtg
accgacatgctcggcgccgagcagatcgacatcgatccgttcgtcgccggcatcgtcacg
ctgggcttcatctacggcgcctacttcaccgagacgtttcgcggcgcgttcctcgcggtg
ccgcgcggccagctcgaagcgggcttcgcgtacggcatgggtgcgtggcgcgtgttcgcg
cggatcatgtttgcgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaggcgaccgcgctcgtgtcgatcatcgggctggccgacgtcgtgaaggcc
gcgcaggacgccggcaagagcacgctgaatttcttcttcttcacgctcgcggcgggcgcg
atctacctcgcgatcacgacgttgtcgaacctcgtgttgatgtacctcgaaaaacgctat
tcggcgggtgtgcggagggtggcgctgtga

DBGET integrated database retrieval system