KEGG   Burkholderia mallei 23344: DM55_4899Help
Entry
DM55_4899         CDS       T03323                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bmal  Burkholderia mallei 23344
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DM55_4899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIO54658
UniProt: A0A3N4FEH7
Position
2:2031894..2033480
Genome map
AA seq 528 aa AA seqDB search
MNPLLSAAASEELGRTRHLGVALLVALLAAGVAYVFVHLFADLAPVGPRSAFPYLLLGVA
LAIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGLWNFLGVMASTGAVAFGILQL
LPVELILQVGHGAGFAMVFALLIAAIAWNLATWYFGLPSSSSHTLIGSIIGVGLANQLMH
GPSGTSGVDWAQAAGVGQSLLLSPLVGFLCAALLLAALKALVRVPALYREPQTNEPPPFW
VRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPGETQTFIAVAHR
ASETLARYAGAAQPSPNPRADVEAYVQSRRLSDATLPAVRRLSDALAAEVGATGSIAKVP
EGQADNVRNTMYLVSEALRLMEKTGRPAFSPADRLALDDYRRQLDHATKFIPTWVKVAVA
IALGLGTMVGWRRIVVTVGEKIGKQHLTYGQGASAEVVAMLTIGAADAYGLPVSTTHVLS
SGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIVLAGALYWAFHALT
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccttctgtccgccgcggcgagcgaagagctcggtcgcacccggcatctgggc
gtcgcgctgctcgtcgccctcctcgccgccggcgtcgcgtacgtgttcgttcacctgttc
gcggatctcgcgcccgtcggcccacgctcggcgtttccgtatctgctgctcggcgtcgcg
ctcgcgatcgcgctcggcttcgagttcgtcaacggcttccacgacaccgcgaacgccgtg
gcgaccgtgatctacacgcattcgctgacgccgaacgtcgcggtcatctggtcgggcctc
tggaattttctcggcgtgatggcgtcgacgggcgcggtcgcgttcggcatcctgcaactg
ctgcccgtcgagctgatcctgcaagtcggccacggcgcgggcttcgcgatggtgttcgcg
ctgctgatcgcggcgatcgcgtggaatctcgcgacctggtacttcggcctgccttcgtcg
agctcgcacacgctgatcggctcgatcatcggcgtcgggctcgcgaatcagctgatgcac
gggccgtccggcacgagcggcgtcgattgggcgcaggcggcgggcgtcggccaatcgctg
ctgctctcgccgctcgtcggcttcctgtgcgcggccctgctgctcgccgcgctgaaggcg
ctcgtgcgcgtgcccgcgctctaccgcgagccgcagacgaacgagccgccgccgttctgg
gtccgctgcctgctgatcctgacctgcaccggcgtgtcgttcgcgcacggctcgaacgac
gggcagaaaggcatggggctcatcatgctgatcctgatcggcaccgtgccgaccgcatac
gcgctcaacaaggcggtcacgcccggcgagacgcaaacgttcatcgccgtcgcacaccgc
gcgtccgaaacgctcgcccgctacgcgggcgccgcgcagccgtcgccgaacccgcgcgcc
gatgtcgaggcttacgtgcagtcgcgccgcctgagcgacgcgacgctgcccgcggttcgc
cggttgtcggacgcgctcgcggccgaagtcggcgcgacgggctcgatcgcgaaagtgccc
gaggggcaggcggacaacgtgcgcaacacgatgtatctggtgtccgaagccctgcgcctg
atggagaaaaccggccggccggcgttctcgccggcggatcgcctcgcgctcgacgactac
cgcaggcagctcgaccacgcgaccaaattcattccgacctgggtgaaggtcgcggtggcg
atcgcgctcggcctcggcacgatggtcggctggcggcgcatcgtcgtgaccgtcggcgag
aagatcggcaagcagcatctgacctatgggcaaggcgcgtcggcggaagtcgtcgcgatg
ctcacgatcggcgcggccgatgcgtacgggctgccggtgtcgacgacgcacgtgctgtct
tccggcgtcgcgggcacgatggccgcgaacggctccgggctgcaatggagcacggtgcgc
agcctcgtgctcgcgtgggtgttgacgctgcccgcgtcgatcgtgctcgcgggcgcgctc
tattgggctttccacgcgctgacctga

DBGET integrated database retrieval system