KEGG   Burkholderia mallei 23344: DM55_963Help
Entry
DM55_963          CDS       T03323                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bmal  Burkholderia mallei 23344
Pathway
bmal00360  Phenylalanine metabolism
bmal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmal00790  Folate biosynthesis
bmal01100  Metabolic pathways
bmal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DM55_963 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DM55_963 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DM55_963 (phhA)
Enzymes [BR:bmal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     DM55_963 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIO50999
Position
1:complement(1048144..1049037)
Genome map
AA seq 297 aa AA seqDB search
MSTVVTAKLKEQFDAGLETRADFTIDQPLARYGDVDHAVWTQLYTRQAALLRGRACDAFI
EGLARIGLAPDRVPSFADVNRRLEPATGWRIVAVPGLVPDAVFFEHLANRRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGRAALRVADDASALALLARLYWYTV
EFGLIRDTRGENGLRIYGAGIVSSKGETLYSLESASPNRIGFDLERVMRTRYRIDTFQKT
YFVIDDFAQLFALADLDARALAARLAGAPEHAAGAVLDGDHVLTRGTGEGWAADADA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccacggtcgttaccgcgaaactgaaggaacagttcgacgcgggcctcgaaacccgc
gccgatttcaccatcgatcagccgctcgcccgctacggcgacgtcgaccacgcggtgtgg
acgcagttgtatacgcggcaggcggcgctgctgcgcggccgtgcatgcgacgcgttcatc
gagggcctcgcgcgcatcggcctcgcgcccgatcgcgtgccgtcgttcgccgacgtgaac
cggcggctcgagcccgcaaccggctggcgcatcgtcgcggtgccgggcctcgtgccggac
gccgttttcttcgagcatctcgcgaaccggcggtttccggtcacctggtggatgcgccgc
ccggaccagctcgattatctacaggagccggactgcttccacgatctgttcggccacgtg
ccgctgctgatcgatcccgtattcgccgactacatgcacgcatacggccgcgcggcgctt
cgcgtcgccgacgacgcaagcgcgctcgcgctccttgcgcgcctctattggtatacggtc
gaattcggcctgattcgcgacacgcgcggcgaaaacgggctgcggatctacggcgcgggc
atcgtgtcgagcaagggcgaaacgctctacagcctcgaaagcgcgtcgccgaaccggatc
ggcttcgatctcgaacgcgtgatgcggacccggtaccggatcgacacgttccagaagacc
tacttcgtgatcgacgatttcgcgcaactcttcgcgctcgccgacctcgacgcgcgcgcg
ctcgccgcgcggctcgccggcgcgcccgagcacgcggcgggcgcggtgcttgacggcgat
catgtgctcacgcgcggcaccggtgaaggctgggcagccgatgcagacgcttga

DBGET integrated database retrieval system