KEGG   Burkholderia mallei BMQ: DM76_1151Help
Entry
DM76_1151         CDS       T03490                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmaq  Burkholderia mallei BMQ
Pathway
bmaq00071  Fatty acid degradation
bmaq00072  Synthesis and degradation of ketone bodies
bmaq00280  Valine, leucine and isoleucine degradation
bmaq00310  Lysine degradation
bmaq00362  Benzoate degradation
bmaq00380  Tryptophan metabolism
bmaq00620  Pyruvate metabolism
bmaq00630  Glyoxylate and dicarboxylate metabolism
bmaq00640  Propanoate metabolism
bmaq00650  Butanoate metabolism
bmaq00900  Terpenoid backbone biosynthesis
bmaq01100  Metabolic pathways
bmaq01110  Biosynthesis of secondary metabolites
bmaq01120  Microbial metabolism in diverse environments
bmaq01130  Biosynthesis of antibiotics
bmaq01200  Carbon metabolism
bmaq01212  Fatty acid metabolism
bmaq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmaq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM76_1151
   00630 Glyoxylate and dicarboxylate metabolism
    DM76_1151
   00640 Propanoate metabolism
    DM76_1151
   00650 Butanoate metabolism
    DM76_1151
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM76_1151
   00072 Synthesis and degradation of ketone bodies
    DM76_1151
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM76_1151
   00310 Lysine degradation
    DM76_1151
   00380 Tryptophan metabolism
    DM76_1151
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM76_1151
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM76_1151
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM76_1151
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmaq04147]
    DM76_1151
Enzymes [BR:bmaq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM76_1151
Exosome [BR:bmaq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM76_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIO62674
Position
1:complement(1260230..1261435)
Genome map
AA seq 401 aa AA seqDB search
MEAYIFDAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTRAVDDVVLGCVEPI
GEQGACIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSEMAIGGGVESM
SRVPMGSSGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAAA
QAGWFARSIVPVRDANGLTILDHDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRY
PELERIEHVHHAGNSSGIVDGASAVLIGSLEAGKRAGLAPRARIRSFASIGSEPSIMLTG
PAYAAQKALERAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacattttcgacgccgtgcgcacgccgcgcggcaaaggcaagaaggacggc
agcctgcacggcgtcacgccgctcgcgctcgccgcaaccgcgctgcgcgcgattcgcgac
cgcaacggtctcgacacgcgcgccgtcgacgacgtcgtgctcggctgcgtcgagcccatc
ggcgagcaaggcgcgtgcatcggccgcatcgcggtgcttgcggccggctacgcggaaacc
acggccggcgtgcagatcaaccgcttctgcgcatcgggcctcgaggcgtgcaacatggcc
gccgcgcaggtgatgtccggccagtcggagatggcgatcggcggcggcgtcgagagcatg
tcgcgcgtgccgatgggctcgagcggcggcgcgtggcccgtcgatccggcgatcgcgatt
ccgagctatttcgtgccgcagggcgtatcggccgacacgatcgcgacgaaatggggctac
agccgtgccgatgtcgacgcgtacgccgccgagagccaccgccgcgcgcacgcggcggcg
caggcgggctggttcgcgcgctcgatcgtgccggtgcgcgacgcgaacggcctgacgatc
ctcgatcacgacgagacgatccgcccgcagacgacgcccgagacgctcgcgacgctcaag
ccttcgttcgccgaactgggtgagatgtacggcttcgacgcggtgatccgccagcgctat
ccggagctcgaacgcatcgagcacgtgcaccacgcgggcaacagctcggggatcgtcgac
ggcgcgtcggccgtgctgatcggctcgctcgaggcgggcaagcgcgcgggcctcgcgccg
cgcgcgcgaatccgctcgttcgcgagcatcggctcggagccgtcgatcatgctgacgggg
ccggcctacgcggcgcagaaggcgctcgagcgcgccggcatgcgcgcggccgacatcgat
ctgtacgagctgaacgaagcgttcgcgtcggtcgtgctgcgcttcatggacgcgatggcg
attgcgcacgaccggatcaacgtgaacggcggcgcgatcgcgatgggccatccgctcggc
gcgacgggcgcgatgatcctcggcacgctgctcgacgagctcgagcggcgcggcgcggcc
acgggccttgcaacgctgtgcgtcggcgccggcatgggcacggcgaccatcatcgaacgg
atttga

DBGET integrated database retrieval system