KEGG   Burkholderia mallei BMQ: DM76_4814Help
Entry
DM76_4814         CDS       T03490                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
bmaq  Burkholderia mallei BMQ
Brite
KEGG Orthology (KO) [BR:bmaq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DM76_4814 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: AIO60905
UniProt: A0A3N4FHH9
Position
2:1941441..1941815
Genome map
AA seq 124 aa AA seqDB search
MSQYRFSVSVKTSYLPEQSDPEHRQYAFAYTLTIRNTGQVAAQLIARHWIITDSESQVQE
VKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatcgattcagcgtgtcggtgaagaccagctatttgccggaacaatccgac
cccgaacaccgtcaatacgcattcgcgtacacgctgacgatccgcaatacggggcaggtg
gccgcgcagttgatcgcccggcactggatcatcacggacagcgagagccaggttcaggag
gtgaaggggctcggcgtcgtcggccatcagccgttgctgcagccgggcgagcagttcgag
tacacgagctgggcggtgatcgcgacgccggtgggcacgatgcgcggcgcgtatttttgc
gtcgcggaggacggcgagcgcttcgaggcgcccgtcgacgaattcgcgctgcacatgccg
cgcacgctgcactga

DBGET integrated database retrieval system