KEGG   Borrelia mayonii: A7X70_03450Help
Entry
A7X70_03450       CDS       T04886                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
bmay  Borrelia mayonii
Pathway
bmay00900  Terpenoid backbone biosynthesis
bmay01110  Biosynthesis of secondary metabolites
bmay01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmay00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7X70_03450
Enzymes [BR:bmay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     A7X70_03450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: APS98861
UniProt: A0A1L6VQT1
Position
727320..728588
Genome map
AA seq 422 aa AA seqDB search
MELSKNFRHKSVLEKRQEIKSFLGLSFKDFFYNNANEDFLFNMIENYIGYLSFPIGIVKN
LKINNKYYSLPIATEESSVVAALNFAAKILENADLRYSLDEVLGISQVYIKSGKDLSKIF
VDLGDKIKTWIEPLLANMNRRGGGFRRLSTRYIKELGIQKLNLYIDTCDAMGANLLNSIA
ERVAEFIFLEFGYECVLKVLSNDIGEFTAKARFVLDFKHLLSGKEDSWNLAKKIELISSI
GFYEEERAVTNNKGIMNGITGVCLSTFNDTRALEASVHKFASKSGKYLPLSKFYTTDNAL
VGEIEIPLQVGTKGGVISFAEASILSFRIMNVNSKSEFIGILSCVGLASNFAALRALAFN
GIQKGHMRLHVDKILYLLKTKYNISDFEKYKLLLEMERMNIYSFDFAFKILKKIRSENAS
KV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaacttagtaaaaattttagacataaaagtgttttagaaaaaaggcaagagataaaa
agttttttgggattatcttttaaagattttttttataataatgccaatgaagattttctt
tttaatatgatagaaaattatattggatatttatcttttcctattggaattgtaaaaaat
ttgaaaataaataacaaatactattctttgccaattgcaaccgaagaatcttctgttgtt
gctgccttaaattttgcagcaaaaattcttgaaaatgctgatttgaggtattctttggat
gaagttttgggaatttctcaagtttatataaaatcgggaaaagatttaagtaaaattttt
gttgatcttggcgataaaatcaagacctggattgaacctcttttagccaatatgaatcga
agggggggtggatttagaagattgtcaactaggtacattaaagagcttggtattcaaaaa
ttaaatctttatattgatacttgtgatgctatgggtgctaatttgttaaactcaattgca
gagcgtgtagcagaatttatttttttagaatttggatatgagtgtgttttaaaagtttta
agcaatgatattggtgaatttacagccaaagcccgttttgttttagattttaagcatttg
ctatcaggtaaagaggattcttggaatttggctaaaaaaattgaacttatttctagcata
ggtttttacgaagaggagcgagctgttactaataataaaggtattatgaatggaattaca
ggggtatgtctttcaacttttaatgatacaagagcgcttgaggcctctgttcataaattt
gcttcaaaaagtggtaaatatcttccccttagtaaattttacactactgacaatgctttg
gttggagaaattgaaattcctttgcaagttggaactaaaggcggtgttatatcttttgct
gaagcttcaattttaagttttagaattatgaatgtaaatagtaaaagtgaatttattggt
attctttcttgtgttggacttgctagtaattttgcagcattaagggctcttgcatttaat
gggattcaaaaaggtcacatgagattgcatgttgataaaatactctaccttttaaagaca
aaatataatatttctgatttcgagaaatacaaattattattggaaatggaaagaatgaat
atttattcttttgattttgcttttaaaattttaaagaaaataaggtcagaaaatgcaagt
aaagtgtaa

DBGET integrated database retrieval system