KEGG   Burkholderia mallei NCTC 10247: BM44_1052Help
Entry
BM44_1052         CDS       T03524                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bmaz  Burkholderia mallei NCTC 10247
Pathway
bmaz00051  Fructose and mannose metabolism
bmaz00520  Amino sugar and nucleotide sugar metabolism
bmaz01100  Metabolic pathways
bmaz01110  Biosynthesis of secondary metabolites
bmaz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BM44_1052
   00520 Amino sugar and nucleotide sugar metabolism
    BM44_1052
Enzymes [BR:bmaz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BM44_1052
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BM44_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 Cupin_1
Motif
Other DBs
NCBI-ProteinID: AIS29509
Position
1:complement(1160913..1162340)
Genome map
AA seq 475 aa AA seqDB search
MNIHPVILCGGSGSRLWPMSRGGYPKQYLKLAGDRSLVQQTALRLRNIPDTTAPIVVTNN
EQRFLVAEQLRQVDITPSSIVLEPVGRNTAPAIAIAALLAMHDSPEALLLVLPSDHVILN
EPAFITAAREAAAIAADKHLVTFGITPTQAHTGFGYIRRGPLLADGGQAFKVDAFVEKPD
ASTAERFVRDSGYYWNSGMFMLKAATYMEELHRHAPEIARQAEFALASAKRDHDFLRLDA
DAFFACPNVSIDYAVMERTERAAVIATADLGWSDIGSWSALADIADTDAQGNALVGDVFT
DSVKNSYIRAEHRMIAALGLDDIVIVETADAVLVAHRDKAQDVRKIVEWLNASGRHESVT
HRRVVRPWGSYEGIDQGERFQVKRIVVNPGAQLSLQMHHHRAEHWIVVKGTALVTNDGKK
IILTENQSTYIPLGATHRLTNPGKIPLELIEVQSGSYLGEDDIVRFEDTYGRTST
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatccggtcatcctgtgcggcggcagcggctcgcgtctttggcccatgtcg
cgcggcggctatcccaagcagtatctgaaactggccggcgatcgatccctggtccagcaa
accgcgctccgtttgcgcaacattccggatacgaccgcaccgatcgttgtcactaacaac
gaacagcgtttcctcgtcgcggaacaacttcgtcaggtcgatatcactccgtcgtcgatc
gtgctggaaccggtcggccgcaatactgcccccgccatcgcgatcgccgcgctgctcgcc
atgcacgactcgcccgaagcgctgctgctggtgctgccatcggaccacgtcatcctcaac
gagccggcattcatcacggcagcccgcgaggcagccgcgatcgcggcggacaagcacctc
gtcaccttcggcatcacacccacgcaggcgcataccggcttcggttatatccggcgcggc
ccgctccttgccgacggtggacaagcgttcaaggtcgatgcattcgtcgagaagcccgac
gcgtcgaccgccgagcgcttcgtcagggacagcgggtactactggaatagcggcatgttc
atgctgaaagccgccacgtacatggaagaactgcatcgccatgcaccggaaattgcccgc
caggccgaattcgccctcgcttcagccaagcgcgaccacgattttcttcgtctcgacgct
gacgcattcttcgcgtgccccaatgtctcgatcgactacgccgtcatggaaaggaccgaa
cgtgctgctgtcatcgcgacggccgacctgggctggagcgacatcggatcgtggagcgca
cttgcggatatcgcggacaccgatgcgcagggtaacgccctcgtcggcgatgtattcacg
gactccgtcaagaactcatatattcgcgcggaacaccggatgattgccgccctcggcctc
gacgacatcgtgatcgtcgaaaccgccgacgccgtgctggtcgcgcatcgcgacaaggcc
caggacgtcaggaagatcgtcgagtggctgaatgcctccggccgccacgaatcggtcacg
catcgccgcgtcgtgcgcccgtggggttcctacgaaggcatcgaccagggcgagcgcttc
caggtgaagcgcatcgtcgtcaatccgggcgcgcaactgagcctgcagatgcatcatcat
cgcgccgagcactggatcgtcgtgaagggcaccgcgctcgtcacgaacgacggcaagaaa
atcatcctgaccgaaaatcagtccacctacattccgctcggcgcaacgcaccggctgacg
aatcccggcaagattccgctcgagctgatcgaggtgcagtccggctcgtatctcggcgaa
gacgacatcgtccgcttcgaggacacgtacgggcgcacgtcgacctga

DBGET integrated database retrieval system