KEGG   Burkholderia mallei NCTC 10247: BM44_1588Help
Entry
BM44_1588         CDS       T03524                                 

Definition
(GenBank) amino ABC transporter, permease , 3-TM region, His/Glu/Gln/Arg/opine family domain protein
  KO
K10016  histidine transport system permease protein
Organism
bmaz  Burkholderia mallei NCTC 10247
Pathway
bmaz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmaz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BM44_1588
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmaz02000]
    BM44_1588
Transporters [BR:bmaz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BM44_1588
   Histidine transporter
    BM44_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 ASC
Motif
Other DBs
NCBI-ProteinID: AIS30101
Position
1:complement(1747804..1748493)
Genome map
AA seq 229 aa AA seqDB search
MFLQGYGPLILSGTWQTVKLAVLSLALSFLLGLVGAAAKLSRSRVSNGIGTLYTTLIRGV
PDLVLMLLLFYSLQIWLNQLTDLMNWDQIDIDPFAAGVLVLGFIYGAYFTETFRGAFLSV
PRGQLEAGSAYGMTNWQVFARVMFPQMMRFALPGIGNNWQVLVKSTALVSIIGLADVVKA
SQDAGKGTLRFFFFTLLAGAIYLAITTISNFVLMWLEKRYSTGVRKADL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttcaaggctacggcccgctgatactctccggcacctggcagaccgtcaagctc
gcggtgctgtcgctcgcgctgtcgttcctgctcggcctcgtcggcgcggcggcgaaactg
tcgcgaagccgcgtctcgaacggaatcggcacgctctacacgacgctcattcgcggcgtg
ccggacctcgtgctgatgctgctcctcttctacagcctgcagatctggctgaaccagctc
accgatctgatgaactgggatcagatcgacatcgatccgttcgcggccggcgtgctcgtg
ctcggcttcatctacggcgcgtacttcaccgaaaccttccgcggcgcgttcctgtcggtg
ccgcgcggccagctcgaggcgggcagcgcgtacgggatgacgaactggcaggtgttcgcg
cgcgtcatgttcccgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaatcgacggcgctcgtgtcgatcatcggcctcgccgacgtggtgaaggcg
tcgcaggacgcgggcaagggcacgctgcggttcttcttcttcacgctgctcgccggcgcg
atctatctcgcgatcacgacgatctcgaacttcgtgctgatgtggctcgagaagcgttat
tcgaccggcgtacgcaaggcagacctatga

DBGET integrated database retrieval system