KEGG   Burkholderia mallei NCTC 10247: BM44_1709Help
Entry
BM44_1709         CDS       T03524                                 

Gene name
cysS
Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
bmaz  Burkholderia mallei NCTC 10247
Pathway
bmaz00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bmaz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BM44_1709 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmaz01007]
    BM44_1709 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmaz03016]
    BM44_1709 (cysS)
Enzymes [BR:bmaz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     BM44_1709 (cysS)
Amino acid related enzymes [BR:bmaz01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BM44_1709 (cysS)
Transfer RNA biogenesis [BR:bmaz03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BM44_1709 (cysS)
 Prokaryotic Type
    BM44_1709 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 DUF5615 DUF3045
Motif
Other DBs
NCBI-ProteinID: AIS28973
UniProt: A3ML43
Position
1:1889732..1891129
Genome map
AA seq 465 aa AA seqDB search
MESLRIYNTLARDKQDFVPRQPGEVRMYVCGITVYDYCHIGHARMVVVFDIVQRWLRARG
YRVTYVRNITDIDDKIIRRAVENGETIQSLTRRFTDAMNADFDALGVERPDLEPRATEFI
PQMLGMIEKLEANGYAYQAKDGDVNYSVRKFANYGRLSGKSLEDLRAGERVAANDAKEDP
LDFVLWKRAKPQEPAGASWESKYGAGRPGWHIECSAMGCTLLGAHFDIHGGGQDLQFPHH
ENEIAQSEGATGQTFVNYWMHNGFVQVDSEKMSKSLGNFFTIREVLEKFDAEVVRFFIVR
THYRSPLNYSDVHLDDARASLTRLYTALKDATPDAQPLDWSEAHAQRFAAAMNDDFNTAV
AVAVLFELATEVNRTREPALARQLRLLAGLLGLLGREPREFLQHAAGAARTGALEPHEIE
ARIAARVAAKQAKNYAEADRIRAELLEAGIALEDKPGGSTEWRRV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggaatcactgcgcatctacaacacgcttgcgcgtgacaagcaagacttcgtgccgcgg
cagcccggcgaagtgcggatgtacgtctgcgggatcaccgtctacgactattgccacatc
ggccatgcgcggatggtggtcgtgttcgacatcgtccagcgctggttgcgcgcgcgcggc
tatcgcgtgacatacgtgcgcaacatcaccgacatcgacgacaagatcatccgccgcgcg
gtcgagaacggcgagacgatccagtcgctcacgcgccgcttcaccgacgcgatgaacgcg
gatttcgacgcgctcggcgtcgagcggccggacctcgagccgcgcgcgaccgagttcatc
ccgcagatgctcgggatgatcgagaagctcgaggcgaacggttacgcgtatcaggcgaag
gacggcgacgtcaactattcggtgcgcaagttcgcgaactacggcaggctctccggcaag
tcactcgaggatttgcgcgcgggcgagcgcgtcgccgcgaacgatgcgaaggaggatccg
ctcgacttcgtgctgtggaagcgcgcgaagccgcaggagccggcgggcgcgtcgtgggaa
tcgaagtacggcgcgggccgcccgggctggcacatcgaatgttcggcgatgggctgcacg
ctgctcggcgcacacttcgacattcacggcggcggccaggacctgcagttcccgcatcac
gagaacgagatcgcgcaaagcgagggtgcgaccggacaaactttcgtcaattattggatg
cacaacggtttcgtgcaggtcgatagtgagaagatgtcgaagtcgctcggcaacttcttc
acgatccgcgaagtgctcgagaagttcgacgccgaggtcgtgcgcttcttcatcgttcgc
acgcattaccgttcgccgctcaactacagcgacgttcatctcgacgacgcgcgcgcatcg
ctcacgcgcctttacacggcattgaaggacgcgacgccggatgcgcagccgctcgactgg
agcgaggcgcacgcgcagcgtttcgccgccgcgatgaacgacgatttcaacacggcggtc
gccgtcgccgtgctgttcgagctcgcgaccgaggtgaaccgcacacgcgagccggcgctc
gcgcgccagctcaggctgcttgcgggcctgctcggcctgctcggccgcgagccgcgcgaa
ttcctgcagcacgcggcgggcgccgcgcgcacgggcgcgctcgagccgcatgagatcgaa
gcgaggatcgccgcgcgcgtcgcggcgaaacaggcgaagaactatgccgaagcggaccgg
atccgcgcggaattgctcgaagccggaatcgcacttgaagacaaaccgggcggatcgacg
gagtggcgccgcgtatga

DBGET integrated database retrieval system