KEGG   Burkholderia mallei NCTC 10247: BM44_2017Help
Entry
BM44_2017         CDS       T03524                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmaz  Burkholderia mallei NCTC 10247
Pathway
bmaz00280  Valine, leucine and isoleucine degradation
bmaz00310  Lysine degradation
bmaz00362  Benzoate degradation
bmaz00380  Tryptophan metabolism
bmaz00620  Pyruvate metabolism
bmaz00630  Glyoxylate and dicarboxylate metabolism
bmaz00640  Propanoate metabolism
bmaz00650  Butanoate metabolism
bmaz00900  Terpenoid backbone biosynthesis
bmaz01100  Metabolic pathways
bmaz01110  Biosynthesis of secondary metabolites
bmaz01120  Microbial metabolism in diverse environments
bmaz01130  Biosynthesis of antibiotics
bmaz01200  Carbon metabolism
bmaz01212  Fatty acid metabolism
bmaz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BM44_2017
   00630 Glyoxylate and dicarboxylate metabolism
    BM44_2017
   00640 Propanoate metabolism
    BM44_2017
   00650 Butanoate metabolism
    BM44_2017
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BM44_2017
   00072 Synthesis and degradation of ketone bodies
    BM44_2017
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BM44_2017
   00310 Lysine degradation
    BM44_2017
   00380 Tryptophan metabolism
    BM44_2017
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BM44_2017
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BM44_2017
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BM44_2017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmaz04147]
    BM44_2017
Enzymes [BR:bmaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BM44_2017
Exosome [BR:bmaz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BM44_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIS27841
Position
1:2246765..2247949
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFAPTELGARVVREVLSRAQVSGDEVGHVVFGNVVHT
EPKDMYLARVAAINGGVAQHAPALTVNRLCGSGLQAIVSAAQNVLLGDADIAVAGGAENM
SRAPYSVPAARFGQRMGDAKLVDMMIGALNDPFQSIHMGVTAENVAAKYGITRDAQDALA
LESHRRASHATKSGYFKDQILPIEIASRKGTVVFDADEHVRHDASLDDFTKLKPVFAKEN
GTVTAGNASGINDAAAAVVLMERGVADKRGAKPLARLVSYAHAGVDPAYMGIGPVPATKK
ALERAGITVADLDVIEANEAFAAQACAVSNALGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAVFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgaagtagtggtggtgagcggcgtacgcacggcgatcggcgatttcggcggc
agcctgaaggacttcgcgccgaccgagctcggcgcgcgggtcgtgcgcgaggtgctgtcg
cgcgcgcaggtgtcgggcgacgaggtcggccacgtcgtgttcggcaatgtcgtgcacacg
gagccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggcggcgtcgcgcagcac
gcgcccgcgctgacggtcaaccgtctctgcggctccggcctgcaggcgatcgtgtcggcc
gcgcagaacgtgctgctcggcgacgcggacatcgcggtcgcgggcggcgcggagaacatg
agccgcgcgccgtactcggtgccggccgcgcgcttcggccagcgcatgggcgatgcgaag
ctcgtcgacatgatgatcggcgcgctcaacgatccgttccagtcgattcacatgggcgtg
acggccgagaacgtcgcggcgaagtacgggatcacgcgcgacgcgcaggacgcgctcgcg
ctcgaatcccaccggcgcgcgtcgcatgcgacgaaatccggctatttcaaggatcagatc
ctgccgatcgagatcgcgtcgcgcaagggcacggtcgtgttcgacgccgacgagcacgtg
cgccacgacgcgtcgctcgacgacttcacgaagctcaagcccgtgttcgccaaggagaac
ggcacggtgacggcgggcaacgcgtcgggcatcaacgatgcggccgccgcggtggtgctg
atggagcgcggcgtcgccgacaagcgcggcgcgaagccgctcgcgcgcctcgtctcgtat
gcgcacgcgggcgtcgatccggcatacatgggcatcggccccgtgcccgcgacgaagaag
gcgctcgagcgcgcgggcatcaccgtcgccgatctcgacgtgatcgaggcgaacgaggcg
ttcgccgcgcaggcgtgcgcggtgtcgaacgcgctcggtctcgatccggcgaaggtcaac
ccgaacggctcgggcatctcgctcggccatccgatcggcgcgacgggcgcgctcatcacc
gtgaaggcgctgtacgagctgcagcggatcggcgggcgctacgcgctcgtcacgatgtgc
atcggcggcgggcagggcattgccgcggtgttcgagcgtctgtga

DBGET integrated database retrieval system