KEGG   Burkholderia mallei NCTC 10247: BM44_2181Help
Entry
BM44_2181         CDS       T03524                                 

Gene name
cbiT
Definition
(GenBank) precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
bmaz  Burkholderia mallei NCTC 10247
Pathway
bmaz00860  Porphyrin and chlorophyll metabolism
bmaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmaz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BM44_2181 (cbiT)
Enzymes [BR:bmaz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     BM44_2181 (cbiT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase SnoaL_2 GidB Methyltransf_4 Methyltransf_24 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AIS29207
Position
1:complement(2432186..2433412)
Genome map
AA seq 408 aa AA seqDB search
MTAWLTVVGIGDDGYAGLGKPARRALADAAVVMGGERHLAMLPARHRAQRAPWPKPFDLA
PLFARRPARVCVLASGDPMLFGVGALLARALAPNEWRVLPAPSSLSLAAARTGWPLQDVD
AVSLVGRPLASLHRHLYPGRRLFVLSADGATPAAIAGALVARGFGPSAMSVFEHLGGPLE
RRLDARADAWRDARAAALNVVAIECRACADAPRLALTPGLPDDAYRHDGQITKRDLRALA
LARLAPAPGELLWDVGAGCGSIGIEWMRAHPSCRTIAIEAHPDRQRFIEHNRDALGVPAL
ELVAGRAPDALAGLRAPDAVFVGGGVSREGVLDACWAGLKPGGRFVAHAVTLQGEAALVA
WRERHGGTLTRVSVAHAQPLGGFDAWRQALPVTLYDARKPRGVQPEHA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgtggctgacggtggtgggcatcggcgacgacggatacgcggggctcggcaag
ccggcgcggcgcgcgctcgccgacgcggcggtggtgatgggcggcgagcggcatctcgcg
atgctgcccgcgcggcatcgcgcgcagcgcgcgccttggccgaagccgttcgatctcgcg
ccgctcttcgcgcggcgtccggcgcgcgtgtgcgtgctcgcgagcggcgatccgatgctg
ttcggcgtcggcgcgctgctcgcgcgcgcgctcgcgccgaacgaatggcgcgtgctgccc
gcgccgtcgtcgctgtcgctcgcggccgcgcgcaccggctggccgttgcaggacgtcgac
gcggtgtcgctcgtcggccggccgctcgcgtcgctgcatcggcacctgtatccgggccgg
cggctgttcgtgctgagcgcggacggcgcgacgcccgccgcgatcgccggcgcgctcgtc
gcgcgcggcttcgggccgagcgcgatgagcgtgttcgagcatctcggcggcccgctcgag
cggcgtctcgacgcgcgcgccgatgcctggcgcgacgcgcgcgcggccgcgctgaacgtc
gtcgcgatcgaatgccgcgcgtgcgccgacgcgccgcgcctggcgctcaccccgggcttg
ccggacgacgcgtatcgccacgacggccagatcacgaagcgcgatctgcgcgcgctcgcg
ctcgcgcggctcgcgcccgcgccgggcgaattgctgtgggacgtcggcgcgggctgcggg
tcgatcggtatcgaatggatgcgcgcgcacccgagttgccggacgatcgcgatcgaggcg
catccggaccggcagcgcttcatcgagcacaaccgcgacgcgctcggcgtgccggcgctc
gagctcgtcgcgggccgcgcgcccgacgcgctcgcgggcctgcgcgcgcccgacgcggtg
ttcgtcggcggcggcgtgagccgcgaaggcgtgctcgacgcttgctgggcgggcctgaag
ccgggggggcgcttcgtcgcgcacgcggtgacgctgcagggcgaggcggcgctcgtcgcg
tggcgcgagcggcatggcggcacgctcacgcgggtgtcggtcgcgcacgcgcagccgctc
ggcggcttcgacgcgtggcggcaggcgctgcccgtcacgctgtacgacgcgcgcaagccg
cgcggcgtgcagccggagcacgcatga

DBGET integrated database retrieval system