KEGG   Burkholderia mallei NCTC 10247: BM44_4044Help
Entry
BM44_4044         CDS       T03524                                 

Definition
(GenBank) polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylase family protein
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bmaz  Burkholderia mallei NCTC 10247
Pathway
bmaz00130  Ubiquinone and other terpenoid-quinone biosynthesis
bmaz00627  Aminobenzoate degradation
bmaz01100  Metabolic pathways
bmaz01110  Biosynthesis of secondary metabolites
bmaz01120  Microbial metabolism in diverse environments
bmaz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmaz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BM44_4044
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BM44_4044
Enzymes [BR:bmaz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BM44_4044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AIS27041
Position
2:complement(1083265..1083861)
Genome map
AA seq 198 aa AA seqDB search
MEPRPAPPRRLIVAITGATGAIYGVRMLDMLRASGGVETHLLISSAGWLNIRHELQLSKD
DVLARADVVHSVRDVGASIASGSFATEGMIVAPCSMKTLASIAHGLSDNLITRAADVALK
ERRRLVLLVREAPFNLAHLRNMTAVTEMGGVIFPPVPAFYAMPKTIDEIVDHTVARVLDM
FALGAPLTPPWQGLREHG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggagccccgtccggcgccgccgcggcgcctgatcgtcgcgatcacgggtgccaccggc
gcgatctatggcgtgcgcatgctcgacatgctgcgcgcgtcgggcggcgtcgagacgcac
ctgctgatctcgagcgccggctggctcaacatccggcacgaactgcaactgtcgaaggac
gacgtgctggcgcgcgccgacgtcgtccattcggtgcgcgacgtcggcgcgagcattgca
tccggctcgttcgcgaccgagggcatgatcgtcgcgccctgctcgatgaagacgctcgcg
agcatcgcgcacgggctatccgacaatctcatcacccgcgccgccgacgtcgcgctgaaa
gagcgccgccggctcgtgctgctcgtgcgcgaggcgccgttcaacctcgcgcacctacgc
aacatgacggccgtcaccgagatgggcggcgtgatcttcccgccggtgcccgcgttctac
gcgatgccgaagacgatcgacgagatcgtcgaccatacggtcgcgcgcgtactcgacatg
ttcgcgctcggcgcgccgctcaccccgccgtggcaagggctgcgcgagcacggctga

DBGET integrated database retrieval system