KEGG   Brucella abortus bv. 1 9-941: BruAb1_0330Help
Entry
BruAb1_0330       CDS       T00241                                 

Definition
(GenBank) apaG protein, hypothetical
  KO
K06195  ApaG protein
Organism
bmb  Brucella abortus bv. 1 9-941
Brite
KEGG Orthology (KO) [BR:bmb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BruAb1_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 PUMA
Motif
Other DBs
NCBI-ProteinID: AAX73730
UniProt: Q57F54
Position
I:complement(337926..338318)
Genome map
AA seq 130 aa AA seqDB search
MYSAVTRGIEVTVEPFYLEVQSEPEENRYVWGYRVTIVNNSSETVQLCSRYWQITDANGH
VQEVRGSGVVGKQPVLDPGDSYQYSSGCPLTTSSGVMVGRYQMKGEDGAQFEIEIPAFSL
DVPEQRRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgcggtaacacgcgggatcgaagttacggtcgagcccttttatctggaagtc
caatccgagccggaagaaaaccgttatgtatggggttatcgcgtcacgatcgtgaacaac
tcatccgaaacggtgcagctttgctcgcgctactggcagatcaccgacgccaacggccat
gtgcaagaagtgcgcggttcaggcgtggtcggcaagcagcctgttctcgatccgggcgat
tcataccagtattcttccggttgcccgctcacaacctcgtcaggcgtgatggtcgggcgc
taccagatgaagggcgaagacggcgcacaattcgagatcgagattcccgccttttcactc
gacgtacccgaacagcgccgcacgctgaactga

DBGET integrated database retrieval system