KEGG   Brucella abortus bv. 1 9-941: BruAb1_0864Help
Entry
BruAb1_0864       CDS       T00241                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
bmb00010  Glycolysis / Gluconeogenesis
bmb00071  Fatty acid degradation
bmb00350  Tyrosine metabolism
bmb00625  Chloroalkane and chloroalkene degradation
bmb00626  Naphthalene degradation
bmb01100  Metabolic pathways
bmb01110  Biosynthesis of secondary metabolites
bmb01120  Microbial metabolism in diverse environments
bmb01130  Biosynthesis of antibiotics
bmb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BruAb1_0864
  Lipid metabolism
   00071 Fatty acid degradation
    BruAb1_0864
  Amino acid metabolism
   00350 Tyrosine metabolism
    BruAb1_0864
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BruAb1_0864
   00626 Naphthalene degradation
    BruAb1_0864
Enzymes [BR:bmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BruAb1_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 PALP adh_short TrkA_N NADH_4Fe-4S MAF_flag10 Limkain-b1 CMAS
Motif
Other DBs
NCBI-ProteinID: AAX74230
UniProt: Q57DQ4
Position
I:complement(847504..848532)
Genome map
AA seq 342 aa AA seqDB search
MRALQLLDDRRLEITDIAPPPLPGMGEVTVRIKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVDAVGPGVSNLLPGQLVSIYGARTCGLCRACREGRDNLCEHVGGVHGFHLDGFA
CEAVNLPARLLVAAPPGVDAIGAAVAPVTFGTVEHMLFDNAKLEPGETVLVQAGGSGIGT
AAIQLAKKMGCTVITTVGSNDKIEKAKALGADHVINYREDRFEGVVRKLTKKKGVDVVFE
HVGADTWAGSMLCMKRGARLVTCGSTSGVSTNMNLMQLFQQQLKIFGSFGCRMENMADAM
QKMARGIVHPVIDTVVGFSDIDTALKRMEGRDVFGKIILQID
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttgcagcttctcgatgatcgccgccttgaaatcaccgatattgcgcccccg
ccgctgcccggcatgggggaagtgaccgttcgcatcaaggccgtggcgctcaaccatatc
gatgtctggggctggcgcggcatggcctttgccaagcgcaagatgccgctcgtcatcggt
gcagaggcttccggtgttgtcgatgctgtcggtcccggcgtttccaatctcctgcccggc
cagctcgtttccatctatggcgcgcgcacctgcgggctttgccgcgcctgccgcgaaggc
cgtgacaatctttgcgaacatgtgggcggcgtgcatggtttccatcttgatggctttgcc
tgcgaagcggtgaaccttcccgcccgcctgctggttgccgcccctcccggcgtggatgct
atcggcgcggctgttgctccggtcacattcggcacggtggaacatatgctgttcgacaat
gccaagcttgaacccggcgaaaccgtgctcgttcaggctggcggctcaggcattggcacg
gctgcgatccagcttgcaaagaagatgggctgcacagtcatcaccacagtcggctccaac
gacaagatcgagaaggccaaggctcttggcgccgatcacgtcatcaattaccgcgaggac
cgtttcgagggcgtggtgcgcaagctcaccaagaagaagggcgtggatgtggtgttcgag
catgtgggcgcggacacatgggcaggctccatgctgtgcatgaagcgcggcgcgcgtctc
gtcacctgcggctcgacctcgggcgtttccacgaacatgaacctgatgcagcttttccag
cagcagttgaagattttcggctccttcggctgccgcatggaaaacatggccgacgccatg
cagaagatggcacgcggcatcgtgcatccggtcatcgacaccgtggttggctttagcgat
atcgacacggcgctgaagcgcatggaaggccgcgacgtcttcggcaagatcattctccag
atcgactga

DBGET integrated database retrieval system