KEGG   Brucella abortus bv. 1 9-941: BruAb1_1144Help
Entry
BruAb1_1144       CDS       T00241                                 

Gene name
tpiA-1
Definition
(GenBank) TpiA-1, triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
bmb00010  Glycolysis / Gluconeogenesis
bmb00051  Fructose and mannose metabolism
bmb00562  Inositol phosphate metabolism
bmb01100  Metabolic pathways
bmb01110  Biosynthesis of secondary metabolites
bmb01120  Microbial metabolism in diverse environments
bmb01130  Biosynthesis of antibiotics
bmb01200  Carbon metabolism
bmb01230  Biosynthesis of amino acids
Module
bmb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BruAb1_1144 (tpiA-1)
   00051 Fructose and mannose metabolism
    BruAb1_1144 (tpiA-1)
   00562 Inositol phosphate metabolism
    BruAb1_1144 (tpiA-1)
Enzymes [BR:bmb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BruAb1_1144 (tpiA-1)
Exosome [BR:bmb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BruAb1_1144 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   BruAb1_1144 (tpiA-1)
  Exosomal proteins of melanoma cells
   BruAb1_1144 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAX74483
UniProt: Q57D01
Position
I:complement(1132838..1133602)
Genome map
AA seq 254 aa AA seqDB search
MTPGIRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEG
ETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAA
WAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTP
TVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLK
AADFLAICETYRNL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactccgggaatccgtccgctggttgctggcaactggaaaatgaatggcaagggagaa
tccctgaccgaactgcgcgccatcgctgcgggcctcagctccgacctcggccgcaagctc
gatgcggtcatatgtgtgccggccaccttgctttcgcgtgcggctgaaacgctggaaggc
gaaacggtcggccttggcggacaggatgcccatttcaagacatccggcgcgcatacgggc
gacatttcgccggaaatgctcaaggaagctggtgccacccatgtcattctcggccattcc
gagcgccgcaccgatcatcacgagagcaataagctcatttgcgccaagacggaagccgca
tgggctgcggggctggtggctatcgtctgcgttggagaaaccgccagcgagcgaaaggcg
gagcgtgcgctcgatgtcattggcgaccagctttccggttcgctgccggatggggttacg
gcggaaaacacaatcattgcctatgaacccgtatgggctatcggcaccgggttgacgccg
acggttcaggatgttcgtgcagcgcacgccttcatgcgtgaacagttgatcgaacgtttc
ggcgcaaaaggcgcgcatctgcgccttctttatgggggttcggtgaagccgtccaatgct
gccgaattgctcggtgttgcagatgttgacggcgctcttgtcggcggcgcgagtttgaag
gcggcagacttcctcgccatatgcgaaacctatcgcaatctataa

DBGET integrated database retrieval system