KEGG   Brucella abortus bv. 1 9-941: BruAb1_1428Help
Entry
BruAb1_1428       CDS       T00241                                 

Gene name
murD
Definition
(GenBank) MurD, UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
bmb00471  D-Glutamine and D-glutamate metabolism
bmb00550  Peptidoglycan biosynthesis
bmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BruAb1_1428 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BruAb1_1428 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmb01011]
    BruAb1_1428 (murD)
Enzymes [BR:bmb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BruAb1_1428 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:bmb01011]
 Precursor biosynthesis
  Amino acid ligase
   BruAb1_1428 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C IlvN Bmp
Motif
Other DBs
NCBI-ProteinID: AAX74758
UniProt: Q57C76
Position
I:complement(1408633..1410036)
Genome map
AA seq 467 aa AA seqDB search
MIPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQ
ADWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAIT
GTNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSL
NPTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGIDDAYCQAIADRLHGAGIR
VVRISKEKHLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA
GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG
GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHAAGDAGN
DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGVMPMRGGS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgatcaccgccctcaaggataaaactgtcgcccttttcggactgggcgggtcg
ggcattgcgactgcaaaggccattgtggcgggcggtgcaaggatcattgcctgggacgat
aatcccgacagtgtggcccgcgcgcaaagtgctggcattgcaacgggcgatctgcggcag
gcggactggtcacagttcgccgtcttcgtgctttcgccgggggttccgctgacccatccg
cagccgcactggtcggtggaccttgcccgcgcggcaggtgttgaaattatcggcgatgtg
gaacttttcgtgcgtgaacgcaaccatatcgcaccggactgccctttcatcgccatcacc
ggcaccaacgggaaatccacgaccacggcgctgatcgcccatatcatcaaggccacgggc
cgggatatgcagcttggcggcaatatcggcaccgcgatcctgacactcgaaccgccgtgt
gccgaccgtttctacgtggtcgaatgctcatcctaccagatcgaccttgcgccatcgctg
aacccgaccgcgggcattctcctgaacctgacgcccgatcatctcgaccgtcacggttcg
atggaaaactatgccgctatcaaggaacggctcgtcgcggcaagcggtacggcgatcatc
ggcatcgatgatgcttattgccaggccattgccgaccggctgcatggcgctggaatacgg
gtggtgcgcatttccaaggaaaagcatctcgacagaggctattttgccgatggcgcaaag
ctgctttgggcgcaggatggggaaattgatgaaatcgcctcgctggaaggcatcggttcg
ctgcgcggcgcgcataatgcgcagaacgcgctggcggcgatcgtcgcctgcctgtcggca
ggcttgagccttgaagaaatccatgccgggttgaagagtttccccggtctggcccatcgc
atggaacaggtcgggcgtcgcgggaaagtcctgtttgtcaacgattccaaggctaccaat
gcggaagcgacggcgcctgcgctctcttcctttccgcagaatatctactggattgtgggc
ggagtaccgaaagccggtggcatcaattcgctcaccgcgtttttcccaagggtcgccaag
gcctatctgatcggtgaagctgccgcccagttcgcggccacactcggcggcgccgtgccg
ttcgagatttccgatacgctggcagccgcagtggcacatgcggcaggtgatgcgggcaat
gatgctgcgcccgaacctgttgtgctgctgtcacccgcctgcgcaagcttcgaccagttc
cagaatttcgagaaacgcggcgacgctttccgcgatgccgttctcgctcttccgggtgtc
atgccaatgagaggaggaagctga

DBGET integrated database retrieval system