KEGG   Brucella abortus bv. 1 9-941: BruAb1_1756Help
Entry
BruAb1_1756       CDS       T00241                                 

Gene name
phbA-1
Definition
(GenBank) PhbA-1, acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
bmb00071  Fatty acid degradation
bmb00072  Synthesis and degradation of ketone bodies
bmb00280  Valine, leucine and isoleucine degradation
bmb00310  Lysine degradation
bmb00362  Benzoate degradation
bmb00380  Tryptophan metabolism
bmb00620  Pyruvate metabolism
bmb00630  Glyoxylate and dicarboxylate metabolism
bmb00640  Propanoate metabolism
bmb00650  Butanoate metabolism
bmb00900  Terpenoid backbone biosynthesis
bmb01100  Metabolic pathways
bmb01110  Biosynthesis of secondary metabolites
bmb01120  Microbial metabolism in diverse environments
bmb01130  Biosynthesis of antibiotics
bmb01200  Carbon metabolism
bmb01212  Fatty acid metabolism
bmb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BruAb1_1756 (phbA-1)
   00630 Glyoxylate and dicarboxylate metabolism
    BruAb1_1756 (phbA-1)
   00640 Propanoate metabolism
    BruAb1_1756 (phbA-1)
   00650 Butanoate metabolism
    BruAb1_1756 (phbA-1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BruAb1_1756 (phbA-1)
   00072 Synthesis and degradation of ketone bodies
    BruAb1_1756 (phbA-1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BruAb1_1756 (phbA-1)
   00310 Lysine degradation
    BruAb1_1756 (phbA-1)
   00380 Tryptophan metabolism
    BruAb1_1756 (phbA-1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BruAb1_1756 (phbA-1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BruAb1_1756 (phbA-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BruAb1_1756 (phbA-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmb04147]
    BruAb1_1756 (phbA-1)
Enzymes [BR:bmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BruAb1_1756 (phbA-1)
Exosome [BR:bmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BruAb1_1756 (phbA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAX75074
UniProt: Q57BB0
Position
I:complement(1719316..1720500)
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGFPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGGVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggtttcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaaggggggtgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system