KEGG   Brucella abortus bv. 1 9-941: BruAb2_0185Help
Entry
BruAb2_0185       CDS       T00241                                 

Definition
(GenBank) glucose/galactose transporter
  KO
K02429  MFS transporter, FHS family, L-fucose permease
Organism
bmb  Brucella abortus bv. 1 9-941
Brite
KEGG Orthology (KO) [BR:bmb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmb02000]
    BruAb2_0185
Transporters [BR:bmb02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    BruAb2_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: AAX75629
UniProt: P0C105
Position
II:complement(177497..178735)
Genome map
AA seq 412 aa AA seqDB search
MATSIPTNNPLHTETSSQKNYGFALTSLTLLFFMWGFITCLNDILIPHLKNVFQLNYTQS
MLIQFCFFGAYFIVSLPAGQLVKRISYKRGIVVGLIVAAIGCALFIPAASYRVYALFLGA
LFVLASGVTILQVAANPYVTILGKPETAASRLTLTQAFNSLGTTVAPVFGAVLILSAATD
ATVNAEADAVRFPYLLLALAFTVLAIIFAILKPPDVQEDEPALSDKKEGSAWQYRHLVLG
AIGIFVYVGAEVSVGSFLVNFLSDPTVAGLSETDAAHHVAYFWGGAMVGRFIGSAAMRYI
DDGKALAFNAFVAIILLFITVATTGHIAMWSVLAIGLFNSIMFPTIFSLALHGLGSHTSQ
GSGILCLAIVGGAIVPLIQGALADAIGIHLAFLMPIICYAYIAFYGLIGSKS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttccatcccaacgaataatccgctgcacactgaaacctcctcccagaaaaat
tacggtttcgcgctcaccagcctcaccttgctgtttttcatgtggggcttcatcacctgt
ctcaacgacatcctgatcccgcatctaaagaacgttttccagctcaactatacccagtcg
atgctgatccagttctgcttcttcggggcctatttcatcgtttccctgcccgcagggcag
cttgtaaagcgcatttcctataagcgtggcatcgtcgtcggcctcatcgtggcggcaatc
ggctgcgcgcttttcatcccggccgcgtcataccgcgtctatgcgctgttcctcggcgcg
ctcttcgtgcttgcgtccggcgttacgatccttcaggttgccgccaatccctatgtgacg
atccttggcaagcctgaaaccgccgcaagccgcctgacactgacacaggccttcaactcg
ctcggcaccacggttgcgccggtctttggcgcagtcctgatcctttcagcggcaacggac
gccaccgtcaatgccgaagccgacgcggttcgcttcccatatcttcttctggcgcttgcc
ttcacggttcttgccatcatctttgcaatcctgaaaccgccggatgtgcaggaagacgaa
cccgccctttccgacaagaaagagggcagcgcctggcaatatcgccacctggttctggga
gcgatcggcattttcgtgtacgtcggcgctgaggtcagcgtcggcagcttcctcgtgaat
ttcctgagcgatcccaccgttgctggcctctccgaaaccgacgccgcccatcacgtggcc
tatttctggggcggggccatggtgggccgcttcatcggctcggcagccatgcgttatatc
gatgacggcaaggcccttgccttcaacgcatttgtcgccatcatcctgctgttcatcacc
gttgccaccacgggccatatcgccatgtggtcggtgctggccatcgggctgttcaattcg
atcatgttccccacgatcttcagcctcgccttgcatggccttggcagccacaccagccag
ggttccggcattttgtgcctggccatcgtcggcggcgcgattgttccgctgatccagggc
gcattggctgatgcgatcggcattcatcttgccttcctgatgccgatcatctgctatgcc
tatatcgccttctatggcctcatcggcagcaaaagctga

DBGET integrated database retrieval system