KEGG   Brucella abortus bv. 1 9-941: BruAb2_0322Help
Entry
BruAb2_0322       CDS       T00241                                 

Gene name
nagA
Definition
(GenBank) NagA, N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
bmb00520  Amino sugar and nucleotide sugar metabolism
bmb01100  Metabolic pathways
bmb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BruAb2_0322 (nagA)
Enzymes [BR:bmb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BruAb2_0322 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AAX75754
UniProt: Q579D0
Position
II:322181..323347
Genome map
AA seq 388 aa AA seqDB search
MMKKSAIAGARIFDGERFHDQSALVFSDGQIEAIVPEASLAEGHEIERLKGGVLAPGFID
AQVNGGGGRMLNDEPTPETMFVIAGGHRKYGTTSLLPTLITDTMPVRDRAIEAAIEAVKA
DRGVAGLHLEGPHLAPARKGAHLAELMRPVNDADIALYIHTARQIGTLLVTLAAEQVTPE
QVRRLSDGGVIVSIGHSDTTAEEAFRRFDAGARSVTHLYNAMSQIGHRAPGLAGAALDHP
DIWCGIVADGHHVDPMALRLALRAKRGDAHLFLVTDAMALVGSDAESFEINGRSVRRVPG
GICSKLVLPDGTIAGSDLDMASAVRFAVAELELTLAEALRMASLYPARYLRLNDRGRFRP
GMRMDAVHLDDGLFAKSTWLSGEKQIAG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaaatcagcaattgcaggcgcgcgcatcttcgacggtgagcgctttcatgac
cagagcgcgctggtattcagcgatggccagatcgaggccatcgtaccggaagcatcgctt
gccgagggccacgaaatcgaaaggctgaagggcggcgttcttgcccccggtttcatcgat
gcgcaggtgaatggcggcggcgggcgtatgctcaatgacgagccgacgcccgaaaccatg
ttcgtgattgccggcgggcacaggaaatacggcacgaccagcctgttgccgacgctcatc
accgatacgatgcccgtgcgtgaccgcgccattgaggcggcgattgaagcggtgaaggct
gacaggggggttgctggcctgcatctggaaggcccgcatctggcgccagcgcgcaaaggc
gcgcatctggcggaactgatgcgcccggtcaatgatgccgatattgcgctctatatccat
acagccaggcagattggcaccttgctggtgacgctcgcggccgaacaggtgacgcctgaa
caggtgcgccgcttgagcgatggaggcgtgatcgtcagcattggccacagcgacacgacc
gctgaagaagccttccggcgcttcgatgccggtgcgcgcagcgtgacgcatctttataat
gccatgagccagattggtcatcgcgcgccgggtcttgccggtgcggcgctcgatcatccc
gatatctggtgcggtatcgttgcggatgggcatcatgtcgatccgatggcgctgcggctg
gcgctgcgtgccaagcgcggcgatgcgcatctgttcctcgtgacggacgccatggcgctt
gtcggatcggatgcggaaagcttcgagataaacgggcgcagcgttcgccgtgtgccgggc
ggcatctgctccaagctggtcctgccggatggcaccattgccggttccgatctcgacatg
gcttcggcggtgcggtttgccgtggcagaactggaactgacgcttgccgaggcgctgcgc
atggcaagcctctatccggcgcgctatctgcgccttaatgatcgcggccggttccgtccg
ggaatgcgcatggatgccgtgcatctggatgacgggctgttcgccaaatccacatggctt
tccggcgaaaagcagattgcaggctga

DBGET integrated database retrieval system