KEGG   Brucella abortus bv. 1 9-941: BruAb2_0439Help
Entry
BruAb2_0439       CDS       T00241                                 

Gene name
fadB
Definition
(GenBank) FadB, fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
bmb00071  Fatty acid degradation
bmb00280  Valine, leucine and isoleucine degradation
bmb00281  Geraniol degradation
bmb00310  Lysine degradation
bmb00362  Benzoate degradation
bmb00380  Tryptophan metabolism
bmb00410  beta-Alanine metabolism
bmb00640  Propanoate metabolism
bmb00650  Butanoate metabolism
bmb00903  Limonene and pinene degradation
bmb00930  Caprolactam degradation
bmb01040  Biosynthesis of unsaturated fatty acids
bmb01100  Metabolic pathways
bmb01110  Biosynthesis of secondary metabolites
bmb01120  Microbial metabolism in diverse environments
bmb01130  Biosynthesis of antibiotics
bmb01200  Carbon metabolism
bmb01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BruAb2_0439 (fadB)
   00650 Butanoate metabolism
    BruAb2_0439 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BruAb2_0439 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BruAb2_0439 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BruAb2_0439 (fadB)
   00310 Lysine degradation
    BruAb2_0439 (fadB)
   00380 Tryptophan metabolism
    BruAb2_0439 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BruAb2_0439 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BruAb2_0439 (fadB)
   00281 Geraniol degradation
    BruAb2_0439 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BruAb2_0439 (fadB)
   00930 Caprolactam degradation
    BruAb2_0439 (fadB)
Enzymes [BR:bmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BruAb2_0439 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BruAb2_0439 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BruAb2_0439 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO UDPG_MGDP_dh_N F420_oxidored FAD_binding_3 NAD_Gly3P_dh_N Sacchrp_dh_NADP ApbA 2-Hacid_dh_C NAD_binding_7 Pyr_redox_2 NAD_binding_8 DFP TrkA_N GIDA Pyr_redox Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AAX75863
UniProt: Q578S1
Position
II:440118..442334
Genome map
AA seq 738 aa AA seqDB search
MAYVNFKVETDADGIALITWDMPEKSMNVFTVDAMQELNAIIDAVIADDKIKGVVITSGK
ETFSGGADLTMLEGMFKEFQKQKVKDPEGAVQTLFDNVGKMSGLFRKLETCGKPWVSAIN
GTCMGGAFEMSLACHARAASDAPGVKMALPEVKVGLFPGAGGTQRVPRLANQQDALQMMT
TGSSLTAQRAKAMGLVTEIAPAKKLVETAKKLIKGGLKPVQPWDEKGFKLPGGAIYSAAG
ANLWPAATAILRRETSGNYPAALAILKSVYEGLLVPFDTGLKIEQRYFTEILQTTEAGMM
IRSLFVSLQELNKGARRPVDEKPTRLKKIGVIGAGFMGAGIAYVTAKAGIPVVLIDRDQE
SADKGKAHTADLITKEMQKGRATEADKEKLLSLITATPDYAQLEGADLVIEAVFEDREVK
RVATEKAEEVLKSSAVFASNTSTLPITGLAKVSKRPKNFIGIHFFSPVDKMMLVEVILGK
KTSDKALAVALDYVRAIKKTPIVVNDTRGFYVNRCVLRYMSEAYNMLVEGVPAAMIENAA
RMAGMPVGPLALNDETAIDLSQKILKATLADLGPKAVDPRHVELVDKLVNEFDRKGRKNG
KGFYDYPAKPAKKHLWPGLKDLYPQQNPDKIDVKELKERFLVTIALEAARVMEEGIVTDP
READVGSILAFGFAPYTGGTLSYIDGMGAKKFVQLAKDLQKKYGAQFKAPKLLLDMAENG
ETFHQRFNPYKGETKKAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgtaaatttcaaggttgaaaccgacgccgacggcattgctctcattacatgg
gacatgcccgaaaagtcgatgaatgtcttcaccgtcgatgcgatgcaggaactgaatgca
atcatcgatgcggtgatagctgacgacaagatcaagggtgttgtcatcacctccggcaag
gaaaccttctccggcggtgccgacctgaccatgctggaaggcatgttcaaggaattccag
aagcagaaggtcaaggaccccgaaggcgcggttcagaccctgttcgacaatgtcggcaag
atgagcggcctgttccgtaagcttgaaacctgcggcaaaccgtgggtttcggccatcaac
ggcacctgcatgggcggcgcatttgaaatgtcgctcgcctgccatgcgcgtgcggcgtcc
gatgcgccgggcgtgaagatggccctgccggaagtgaaggtcggccttttccccggtgct
ggcggcacgcagcgcgttccgcgccttgccaaccagcaggacgcgcttcagatgatgacg
acgggttcaagcctcaccgcgcagcgcgccaaggctatgggccttgtcaccgagattgct
ccggccaagaagctggtcgaaacagccaagaagctcatcaagggtggcctcaagccggtt
cagccctgggatgaaaagggcttcaagctgccgggcggcgcgatttattcggctgctggt
gcaaacctctggcctgccgcgaccgccatcctgcgtcgcgaaacatcgggtaattatccg
gcggcactcgccattttgaagtcggtttatgagggccttctggtgcctttcgacaccggc
ctcaagattgaacagcgctatttcaccgaaatcctccagacgaccgaagcgggcatgatg
atccgctcgctcttcgtgtcgttgcaggagttgaacaagggtgcgcgccgtccggttgac
gaaaagccgaccaggctcaagaagatcggcgtcatcggcgcgggcttcatgggtgcaggc
attgcctatgtgacggcgaaggccggtattccggtcgtgctgatcgaccgcgatcaggaa
tctgccgacaagggcaaggcccacacggcagacctaatcaccaaggaaatgcagaagggc
cgtgccaccgaggccgacaaggaaaaacttctgtcgctcatcacagcaacgccggattat
gcccagcttgaaggtgctgatctggtgattgaagccgtgttcgaggaccgcgaagtcaag
cgcgttgcgaccgagaaggccgaggaagtgctgaaatcttccgcagtcttcgcctccaac
acctcgaccctgccgatcaccggtcttgccaaagtgtcgaagcgtccgaagaattttatc
ggcatccacttcttctcgcctgtcgacaagatgatgctggtggaagtgatcctcggcaag
aagacctctgacaaggcattggccgtagcactcgattatgtccgtgcgatcaagaagacg
ccgatcgtcgtcaacgatacgcgcggcttctacgtcaaccgttgcgtgctgcgctatatg
tcggaagcctacaacatgcttgttgaaggcgtcccggcggcgatgatcgaaaatgccgcc
cgcatggccggtatgccggtcggcccgcttgcgctcaacgacgaaacggccatcgacctg
tcgcagaagatcctgaaagccacgcttgccgatcttggtccgaaggccgttgacccgcgc
catgtggaattggtggacaagcttgtcaacgagttcgaccgcaagggccgcaagaatggc
aagggcttctacgattatccggcaaagcctgccaagaagcatttgtggccgggtctgaaa
gacctctatccgcagcagaacccggacaagatcgatgtgaaggagcttaaagagcgcttc
ctcgtcaccatcgctctggaagctgcccgcgtgatggaagaaggcattgtgaccgatccg
cgtgaagccgatgtcggctccatcctcgccttcggtttcgcgccttatacgggcggcacg
ctctcctatatcgacggtatgggcgcgaagaaattcgtccagctcgccaaggatttgcag
aagaaatatggcgcacagttcaaggcgccgaagcttctgctcgatatggccgagaacggc
gaaaccttccaccagcgtttcaatccctataagggcgaaacgaaaaaagcagcctga

DBGET integrated database retrieval system