KEGG   Brucella abortus bv. 1 9-941: BruAb2_1135Help
Entry
BruAb2_1135       CDS       T00241                                 

Gene name
hemN-2
Definition
(GenBank) HemN-2, oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bmb  Brucella abortus bv. 1 9-941
Pathway
bmb00860  Porphyrin and chlorophyll metabolism
bmb01100  Metabolic pathways
bmb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BruAb2_1135 (hemN-2)
Enzymes [BR:bmb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BruAb2_1135 (hemN-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C CbiC
Motif
Other DBs
NCBI-ProteinID: AAX76504
UniProt: Q576D0
Position
II:complement(1157493..1158845)
Genome map
AA seq 450 aa AA seqDB search
MSQTIVEKYGEARLPRYTSYPTAPNFKAEIVPGAYGRWLNSIPDDQDTSLYLHIPFCRSM
CWYCGCHTTITEKDRPILDYLDVLHKEIEMIARQRGRSFNLGEIHFGGGTPTIIQPDELV
ALMAALRDRLGFAGELNAAVEIDPRRMTPEMAAALAYSGITRASLGVQSFDPKVQKAINR
IQTAKTTLETVSSLRKNNIQAINFDLIYGLPHQTVASCIETVDIAVEMRPNRFAVFGYAH
VPGFKKHQRLIDEKALPDVQARHAQAAAIAERLVEAGYEQIGLDHFALPDDDLSIAQREG
RLHRNFQGYTTDACKTLIGIGASAIGRFGNGYHQNIVPPGLYASCVASGEPPTAKIYELT
AEDRVRADVIEQLMCNFSVNVAAVCAAHGFDPEVLMKQNDTLDELEKDGLVQREGFMVRV
DGRHRFIVRAVASAFDAYLASSKTNFSKTA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagacaatcgtggaaaaatatggcgaggcgcggctaccccggtatacgagctac
ccgacggctcccaatttcaaggccgagattgtgcccggtgcctatgggcgctggctgaat
tcgatcccggacgatcaggacacctcgctttatcttcatattccgttttgccggtctatg
tgctggtattgcgggtgccacaccacgattacggagaaagaccggccgatcctcgattat
ctcgatgttctgcacaaggaaatcgagatgatagccaggcaacgcggccgcagtttcaat
ctcggtgaaattcattttggcggcggaacgccgaccatcattcagcccgatgaattagtc
gcactcatggcggcccttcgagaccggctcggctttgccggggaattgaatgcagcggtg
gagatcgatccgcgccggatgacgcctgaaatggccgcagccctggcatattccggcata
acgcgggcaagtcttggtgtgcagagcttcgaccccaaggtgcaaaaggcaatcaaccgc
attcaaacggccaagaccacgcttgaaaccgtctcaagcctgcggaagaacaatattcag
gcgataaacttcgaccttatctatgggttgccacatcagacggtggcatcctgcatcgag
acagtcgatatagcggttgagatgcggccaaaccggtttgcggtatttggctatgcgcat
gtgccgggtttcaaaaagcaccagagactgatcgatgagaaggcgcttcccgatgtgcag
gcgcggcacgcccaggcagcggcaattgccgagcgtctggttgaggccggttacgaacag
atcggtctggatcatttcgcgctgccggatgatgatctctccatcgcccagcgcgagggg
cggctgcatcgcaatttccagggctataccaccgatgcctgcaagacgctgatcgggatc
ggcgcttctgcaattggcaggttcggcaatggctatcatcagaatatcgttcctccgggg
ctttatgcgagctgtgttgcatcgggtgaaccgcccaccgccaagatttatgaactgacg
gcggaggaccgggtgagggccgatgtgattgaacagctcatgtgcaatttctcggtcaat
gtcgccgcagtctgcgctgcacacggcttcgacccggaagtgctgatgaagcaaaacgac
acgctggatgaactggagaaagacggcctcgtgcagcgggaagggtttatggttcgcgtg
gatggcaggcatcgcttcatcgtgcgcgccgttgcatcggctttcgatgcctatctggcc
agctcgaaaacaaacttcagcaagactgcctga

DBGET integrated database retrieval system