KEGG   Brucella abortus S19: BAbS19_I09400Help
Entry
BAbS19_I09400     CDS       T00703                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bmc  Brucella abortus S19
Pathway
bmc00450  Selenocompound metabolism
bmc00970  Aminoacyl-tRNA biosynthesis
bmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BAbS19_I09400
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAbS19_I09400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bmc01007]
    BAbS19_I09400
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmc03016]
    BAbS19_I09400
Enzymes [BR:bmc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BAbS19_I09400
Amino acid related enzymes [BR:bmc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BAbS19_I09400
Transfer RNA biogenesis [BR:bmc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BAbS19_I09400
 Prokaryotic type
   Other AARSs
    BAbS19_I09400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF2529
Motif
Other DBs
NCBI-ProteinID: ACD72455
UniProt: A0A0F6AQN9
Structure
PDB: 

Position
1:975571..977118
Genome map
AA seq 515 aa AA seqDB search
MSREKYYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQS
ARKEGITPRDLADRNTSAFRRMAEVLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYK
GGYAGWYSVRDEAYYGEEETEVRADGVRYGPQGTPVEWVEEESYFFRLSAYQDKLLDLYE
NNPGFIMPAERRNEIVSFVKSGLKDLSISRTTFDWGIPVPGDEKHVMYVWVDALTNYITA
LGYPDTTDERWAYWPANAHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEK
MSKSVGNVIDPFELVERYGLDQLRYFLMREVPFGQDGSYSHEAIVNRTNADLANDLGNLA
QRSLSMIAKNCEGKVPQPGAFSEADKAILDQADAALETARKAMDDQALHLALGAIFAVVA
EANRYFAGQEPWALRKTDPARMGTVLYVTAEVLRRVGIMVQPFIPQSAEKLLDILAVPAD
KRQFADVLASPLAGGTDLPAPQPVFPRYVEADEQN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaaaaatattacatcacgactgcgattgcttatccgaacggaaagccgcat
atcggccacgcttacgaactgatcgcgaccgatgccatggcgcggtttcagcgtctcaat
ggcatggatgtttattttctgaccggcacggacgagcatggcatcaagatgctgcaaagc
gcgcgcaaggaaggcattacgccgcgcgatctggcagaccgcaacacatccgccttccgt
cgaatggctgaagtgctgaacagctccaacgacgactatatccgcacctccgaagagcgt
cattacaaggccagccaggccatttggcaggcgatggtcgcaaatggggatatttacaag
ggcggctatgccggctggtattccgtgcgcgacgaagcctattacggcgaggaagaaacg
gaagtgcgcgcggatggcgtccgctacggcccgcagggaacgcctgtggaatgggtggag
gaggaaagctatttcttccgtctttcggcctatcaggacaagctgctcgacctctacgag
aacaatccgggctttatcatgcccgccgaacgccgcaatgagattgtgagcttcgtgaag
tcaggtctcaaggacctgtcgatttcgcgcacgaccttcgattggggcattccggtgccg
ggagatgaaaagcacgtcatgtatgtgtgggtggatgcgctcaccaattacatcactgcg
ctcggctatcctgatacgaccgatgagcgttgggcttactggcccgccaatgcccatatc
atcggcaaggatatttcccgcttccatgcggtctattggcctgcattcctgatgtcggcc
caattacccttgccgaagcgtgttttcgcgcatgggttcctgttcaatcgcggcgagaaa
atgtcgaagtcagtcggcaatgttatcgatccgtttgaactggtggagcgttacggcctg
gaccagttgcgttatttcctgatgcgtgaagtgccattcggccaggatggcagctacagc
catgaggcgatcgtcaaccgcaccaatgccgatctggccaacgacctcggcaatcttgcc
cagcgttcgctatcgatgatcgccaagaattgcgaaggcaaggtgccgcagcccggcgca
ttttccgaggctgacaaggccattctggatcaggccgatgccgcgctcgaaaccgcgcgc
aaggcaatggacgatcaggccctgcatctggcattgggtgcgatcttcgctgttgtggcg
gaagccaaccgctattttgcggggcaggagccatgggcactgcgcaagaccgatcctgcg
cgcatgggcaccgtgctctatgtaacagccgaggttctgcgccgcgtcggcatcatggtg
cagcctttcatcccgcaatctgcggagaagctgctcgatattctggctgtcccggctgac
aagcgccagtttgccgatgtgctggcaagcccgcttgctggtgggaccgatctgcctgcg
ccgcagccggtcttcccgcgctatgtggaagcggacgaacagaactga

DBGET integrated database retrieval system