KEGG   Brucella abortus S19: BAbS19_I16740Help
Entry
BAbS19_I16740     CDS       T00703                                 

Definition
(GenBank) Pyc, pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
bmc  Brucella abortus S19
Pathway
bmc00020  Citrate cycle (TCA cycle)
bmc00620  Pyruvate metabolism
bmc01100  Metabolic pathways
bmc01120  Microbial metabolism in diverse environments
bmc01200  Carbon metabolism
bmc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAbS19_I16740
   00620 Pyruvate metabolism
    BAbS19_I16740
Enzymes [BR:bmc01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BAbS19_I16740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_3 HlyD_D23 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACD73156
UniProt: A0A0F6ASD8
Position
1:complement(1725235..1728711)
Genome map
AA seq 1158 aa AA seqDB search
MSFAPKPISKILVANRSEIAIRVFRAANELGLKTVTIWAEEDKLSLHRFKADESYQVGRG
PHLDRDLGPIESYLSIDEIIRVAKLSGADAIHPGYGLLSESPEFAEACAENGIVFIGPKP
ETMRRLGNKVAARNLAIEIGVPVVPATDPLPDDMDEVKKLAAQIGYPLMLKASWGGGGRG
MRAIRAEADLAREVMEAKREAKAAFGKDEVYLEKLVERARHVEVQILGDTYGNAVHLFER
DCSIQRRNQKVVERAPAPYLNDAQRRELADYGLKIAHATDYIGAGTVEFLMDADTGKFYF
IEVNPRIQVEHTVTEEVTGIDIVKAQIHILEGFAIGTPESGVPRQEDIRLNGHALQCRIT
TEDPEQNFIPDYGRIQAYRSAAGFGIRLDGGTAYSGAFITRYYDPLLVKVTASGATPLEA
IHRMDRALREFRIRGVATNLTFLEAIINHPKFQSNDYTTRFIDTTPELFEQMKRQDRATK
LLTYIADVTVNGHPETKGRAKPARDAAKPRVPWFGDKLVADGTKQLLGQLGPKKFAEWMR
NEKRALITDTTMRDGHQSLLATRVRTYDIARIANAYAQALPNLFSLECWGGATFDVSMRF
LTEDPWERLALVREGAPNLLLQMLLRGANGVGYKSYPDNVVKYFVREAARAGIDLFRVFD
SLNWVENMRVSMDAVLEENKLCEAAICYTGDILNPDRAKYDLNYYVNLAKEVEKAGAHII
AVKDMAGLLKPAAARVLFKALREETDLPIHFHTHDTSGISAATVLAAIDAGVDVVDAAMD
ALSGNTSQPCLGSIVEALHGSERDSGLDPDSIRRISFYWEAVRHQYAAFESDLKGPASEV
YLHEMPGGQFTNLKEQARSLGLETRWHEVAQAYADVNRMFGDIVKVTPSSKVVGDMALMM
VAQDLTVADVENPAKDIAFPDSVVSMMRGDLGQPPSGWPEALQKKVLKGEKPFTVRPGSL
LPAADLDAERKSFEDSVGRKLSDQEFASALMYPKVFTDYATAHETYGPTSVLPTPVYFYG
LKPEEEVFVDLERGKTLVIVNQAMSETDEKGMVTVFFELNGQPRRIKVPNRAKGASGGVR
RKVEAGNDKQVGAPMPGVISTVAVVAGQKVTQGDVLLSIEAMKMETAIHAERDGTIAEVL
VRPGEQIDAKDLLIVYAE
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttcgctccaaagcctatctcgaaaattctggtcgccaaccgatctgaaatcgca
attcgcgtattccgcgccgccaatgagctggggctcaaaacggtgaccatatgggctgag
gaagacaagctttccctgcatcgcttcaaggcggatgaaagctatcaggtcggtcgcgga
ccgcatctggatcgcgatcttggccccattgaaagctatctttccattgacgaaatcatc
cgcgttgccaagctttcgggcgccgatgcgatccatccaggttacggtctcctgtcggaa
agcccggaatttgccgaagcctgcgcggaaaacggtatcgtcttcatcgggccgaagccg
gaaaccatgcgccgcctcggcaacaaggtcgccgcgcgcaatctcgctatcgagattggc
gtgccggtggtgcctgccaccgatccgctgccggatgatatggatgaggtgaagaagctt
gccgcccagatcggctatccgctgatgctgaaagcaagctggggcggcggcggccgcggt
atgcgcgccatccgggctgaagccgatcttgcccgcgaggtgatggaagccaagcgcgag
gccaaggcggcctttggcaaggatgaagtttatctcgaaaagctggtggagcgtgcccgc
catgtcgaagtgcagatattgggcgatacgtacggcaatgcggtccatctttttgagcgt
gactgctccatccagcgccgtaaccagaaggtcgtggagcgcgcgcctgcaccctatctc
aacgatgcgcagcgccgcgagctggccgattatggcctgaagatcgcgcatgccaccgat
tatatcggtgctggcacggttgagttcctcatggatgccgataccggcaagttctatttc
atcgaggtcaatccacgcattcaggtggagcatacggtcacggaagaagtgaccggcatc
gatatcgtcaaggcgcagatccatattctggaaggctttgccatcggcacgccggaatcg
ggcgtgccgcgccaggaggatatccgcctcaatggccacgcgctgcaatgccgcatcaca
acggaagacccggaacagaatttcatccccgattacgggcgcattcaggcctatcgttcg
gcggcgggcttcggcatccgtctcgatggcggcacggcctattcgggcgcattcatcacc
cgttattacgacccgcttctggtaaaggtgacggcatccggcgcgacgccgcttgaagcc
attcaccgcatggaccgcgccttgcgcgagttccgcattcgcggcgtggcaacgaacctc
accttcctcgaagcgatcatcaatcatccgaaattccagtcgaacgattatacgacccgt
ttcatcgatacgacgccggaattgttcgagcagatgaagcggcaggatcgcgccaccaag
cttttgacctatattgccgatgtgaccgtcaacggccatcccgaaaccaagggccgcgcg
aaacccgccagggatgctgccaagccgcgcgtgccgtggtttggcgacaagctggtcgct
gacggcaccaaacagcttctgggccagcttgggccgaagaagtttgccgaatggatgcgc
aatgaaaagcgcgcgctgattactgataccaccatgcgcgatggccaccagtcattgctt
gccacgcgcgtgcgcacctatgatattgcgcggatcgccaatgcttacgcgcaggcgctg
ccaaacctattctcgctggaatgctggggcggggctactttcgacgtctccatgcgcttc
ctgaccgaagacccgtgggagcgtctggcactggtgcgcgaaggcgcgcccaacctcctg
ttgcagatgcttctgcgcggtgcgaacggggttggctacaaatcctatccggacaatgtg
gtgaaatatttcgtgcgcgaggcagcgcgcgcgggcattgacctgttccgcgttttcgac
agcctcaactgggttgagaacatgcgcgtgtcgatggatgcggtgctggaggaaaacaag
ctctgtgaagcggcgatctgctatacgggcgatattttgaacccggatcgcgccaaatac
gaccttaattattacgtcaatctggcgaaggaagtggaaaaggctggcgcgcatattatt
gcggtcaaggatatggcgggcttgctgaagcctgccgccgcgcgcgtgctgttcaaggcg
ctgcgcgaggaaaccgatctgccgatccatttccacacacatgatacgtcgggcatttcg
gcggcgaccgtgcttgctgcaatcgatgcgggcgtggatgtcgtggatgcagcgatggac
gcactttcgggcaatacatcgcagccctgcctcggttccatcgttgaagcgctgcatggt
tccgagcgtgattcggggctcgacccggattcgatccgccgtatttccttttattgggaa
gcggtgcgccatcaatatgcagcttttgaaagcgacctcaagggaccggcttcggaagtc
tatcttcacgaaatgccgggtggccagttcaccaatctgaaggaacaggcgcgctcgctg
gggcttgaaacgcgctggcatgaagtggcgcaggcctatgccgatgtgaaccgcatgttc
ggcgatatcgtcaaggtcacgccatcctccaaggtggtgggcgacatggcgctgatgatg
gttgcccaagacctcactgttgccgatgtcgagaaccctgccaaggatattgccttcccg
gattcggtggtttccatgatgcgtggcgatctcggccagccgccatccggctggccggaa
gccttgcagaaaaaggttctgaaaggtgaaaagcctttcaccgtgcgccccggctcgctt
ctgcctgccgccgatctcgatgcggaacgcaagagctttgaggacagtgtcggccgcaag
ctttccgatcaggaatttgcttcggcgctgatgtatccgaaggtcttcaccgattatgct
acggcgcatgaaacctatggtccgacgagcgtgctgccgacgccggtttatttctacggc
ctcaagccggaagaagaagtttttgtcgatctggagcgtggcaagacgctggtgatcgtc
aatcaggctatgagcgagaccgacgagaagggcatggtgacggtgttcttcgagctgaac
ggccagccgcgccgcatcaaggtgccaaaccgtgccaagggtgcttccggtggtgtccgc
cgcaaggtggaggcgggcaatgacaaacaggtcggtgcgccaatgccgggcgttatctcc
accgttgcggttgtggcaggccagaaggttacgcagggcgacgtgcttctatccatcgag
gcgatgaagatggaaaccgccatccatgccgaacgcgatggcactatcgcggaagtgctg
gtccgccccggcgagcagatcgacgcgaaggatttgctcatcgtttacgccgagtaa

DBGET integrated database retrieval system