KEGG   Brucella abortus S19: BAbS19_I19730Help
Entry
BAbS19_I19730     CDS       T00703                                 

Definition
(GenBank) Tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bmc  Brucella abortus S19
Pathway
bmc00260  Glycine, serine and threonine metabolism
bmc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmc01100  Metabolic pathways
bmc01110  Biosynthesis of secondary metabolites
bmc01130  Biosynthesis of antibiotics
bmc01230  Biosynthesis of amino acids
Module
bmc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAbS19_I19730
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAbS19_I19730
Enzymes [BR:bmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAbS19_I19730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG DUF561 Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACD73455
UniProt: B2S9A3
Position
1:complement(2048610..2049449)
Genome map
AA seq 279 aa AA seqDB search
MTTRIDTKFAELKAEGRPALVTYFMGGDPDLETALKVMKALPKAGADVIELGMPFSDPMA
DGPAIQAAGLRALNAGQTLAKTLYMAAEFRKEDDTTPIVMMGYYNPIYVYGVERFLTDAK
ASGVDGLIVVDLPSEMDAELCIPAMKAGINFIRLTTPTTDDKRLPKVLHNSSGFVYYVSM
NGITGAAIADTAKVGEAVRHIKKSTDLPICVGFGVKTPEQAAAIATHADSVVVGTAIVNA
IAGELDEKGKVKGDPVAAATRLVHALAESVRATRLEAAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgcatcgacaccaaattcgccgaactgaaggccgagggccgtccggcgctc
gtcacctatttcatgggcggcgatcccgatctggaaaccgcgctgaaggtgatgaaagcc
ctgccgaaagccggcgctgacgtgatcgagcttggtatgcccttctccgacccgatggcg
gatggacccgccattcaggcggctggccttcgcgccctgaacgccggacagacgctggcg
aagacgctttatatggcagcagaattccgcaaggaagacgatacgaccccgatcgtcatg
atgggctattacaatccgatctatgtctatggcgtggagcgttttctgaccgatgccaag
gcatccggcgtggatgggctgatcgttgtcgatcttccttccgaaatggatgccgagctt
tgcattccggcaatgaaggcgggcatcaatttcatccgcctcaccacgccgaccacggac
gacaagcgcctgccgaaagtgctgcataattcatcgggctttgtctattatgtctcgatg
aacggcatcaccggcgcggccattgccgatacggcaaaggtcggcgaagcggttcgccat
atcaagaaaagcaccgacctgccgatctgtgtcggtttcggcgtcaagacgccggaacag
gctgcggcaatcgcaacccatgccgatagcgtcgtcgtgggcacggccattgtcaacgca
attgccggtgaactcgatgaaaagggcaaggtgaagggtgatccggttgccgccgcaacc
cggcttgtccacgctcttgcagagagtgtgcgcgccacacgccttgaagccgcccaataa

DBGET integrated database retrieval system