KEGG   Brucella abortus S19: BAbS19_II00560Help
Entry
BAbS19_II00560    CDS       T00703                                 

Definition
(GenBank) VirB8
  KO
K03203  type IV secretion system protein VirB8
Organism
bmc  Brucella abortus S19
Pathway
bmc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BAbS19_II00560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmc02044]
    BAbS19_II00560
Secretion system [BR:bmc02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BAbS19_II00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: ACD73583
UniProt: A0A0F6ATE8
Position
2:complement(59744..60463)
Genome map
AA seq 239 aa AA seqDB search
MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGI
GIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWY
TLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRF
AKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPLGFNVTSYRVDPEMGVVQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtttggacgcaaacaatctccacagaaatcagtaaagaacgggcagggcaatgcgcct
tcggtatatgacgaagcgttgaactgggaggccgcgcacgtccggcttgtcgaaaaatcc
gaacgccgcgcgtggaaaatcgccggggctttcggcaccattaccgtgctgctcgggatc
ggcatcgccgggatgttaccgctaaagcaacatgtgccctacctggtgcgcgtcaacgca
cagacaggtgcgcctgatatcctgacctcgctcgacgagaagagtgtcagctacgacact
gtaatggataaatactggctctcgcagtacgtgatagcgcgtgaaacctacgactggtac
acgctgcaaaaggactacgaaaccgtaggcatgttgtcgtcgccgtccgaagggcagagc
tatgcaagccagttccagggcgataaggcgcttgacaagcaatatggctcaaatgtgcgc
acatcggtaacgatcgtaagcatcgtgccgaacggcaagggcatcggcacggtgcgcttt
gcgaagacgacaaagcgcaccaacgagaccggtgacggcgaaacaacgcactggatcgcc
accattggctaccaatacgtcaatccctctttgatgtcggaatcggcccgcctgacaaac
ccgctgggtttcaatgtcacgagctatcgcgttgatccagaaatgggagtggtgcaatga

DBGET integrated database retrieval system