KEGG   Brucella abortus S19: BAbS19_II03190Help
Entry
BAbS19_II03190    CDS       T00703                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bmc  Brucella abortus S19
Pathway
bmc00220  Arginine biosynthesis
bmc00330  Arginine and proline metabolism
bmc01100  Metabolic pathways
bmc01110  Biosynthesis of secondary metabolites
bmc01130  Biosynthesis of antibiotics
bmc01230  Biosynthesis of amino acids
Module
bmc_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BAbS19_II03190
   00330 Arginine and proline metabolism
    BAbS19_II03190
Enzymes [BR:bmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BAbS19_II03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACD73828
UniProt: A0A0F6AU25
Position
2:335512..336432
Genome map
AA seq 306 aa AA seqDB search
MHCKILGLPVQEGTGRKGCNMGPDSYRAAGIADAIRELGHECTDLGNLAPAAQRPLQHPN
HAIKALPYAVAWIEAISEAAYRESAEGFPIFLGGDHLLAAGTVPGIARRAAEKGRKQFVL
WLDAHTDFHTLETTTSGNLHGTPVAYYTGQKGFEGYFPKLAAPIDPHNVCMLGIRSVDPA
EREAVKKTEVIVYDMRLIDEHGVAALLRRFLERVKAEDGLLHVSLDVDFLDPSIAPAVGT
TVPGGATFREAHLIMEMLHDSGLVTSLDLVELNPFLDERGRTAAVMVDLMASLLGRSVMD
RPTISY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcattgtaagattctggggctgcccgttcaggaaggcactggccgcaagggctgtaat
atggggcctgattcctatcgtgcggccgggattgccgatgccataagggaacttgggcac
gagtgcacagatttgggcaatctggcgcctgccgcccagcgcccgctacagcatccgaac
catgcaatcaaggcgcttccatatgccgttgcctggatcgaagcgatcagcgaagcggcc
tatcgcgaaagtgcggaagggttcccgatctttcttggtggcgatcaccttctggcagcg
ggcacggttcccggtattgcgcgccgcgccgctgaaaaggggcgcaagcaattcgtgctc
tggctcgatgcgcatacggatttccatacgctggaaaccacgaccagcggcaatcttcat
ggtacgcccgttgcttattataccggtcagaagggctttgagggctatttccccaagctt
gcagcgccgatcgatccgcataatgtctgcatgttgggcattcgcagcgtcgatccggct
gagcgggaagcggtcaagaaaacagaagttatcgtctatgacatgcggctgatcgacgag
catggtgttgccgccctgctgcgccggtttctggagcgcgtgaaggcggaagacgggctg
ttgcatgtgagccttgatgtcgattttctcgatccctccatcgcgccggccgtgggtacg
acggtgcctggcggcgcgaccttccgtgaggcgcatctcatcatggagatgctgcacgac
agcgggctggtgacgagcctcgatctcgttgaactcaatccctttcttgatgagcgcggc
cgcacggccgccgtcatggtggacctgatggcgagccttctgggccgcagcgtcatggac
cgcccgaccatcagctattga

DBGET integrated database retrieval system