KEGG   Brucella abortus S19: BAbS19_II07300Help
Entry
BAbS19_II07300    CDS       T00703                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmc  Brucella abortus S19
Pathway
bmc00010  Glycolysis / Gluconeogenesis
bmc00620  Pyruvate metabolism
bmc00640  Propanoate metabolism
bmc00680  Methane metabolism
bmc01100  Metabolic pathways
bmc01110  Biosynthesis of secondary metabolites
bmc01120  Microbial metabolism in diverse environments
bmc01130  Biosynthesis of antibiotics
bmc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAbS19_II07300
   00620 Pyruvate metabolism
    BAbS19_II07300
   00640 Propanoate metabolism
    BAbS19_II07300
  Energy metabolism
   00680 Methane metabolism
    BAbS19_II07300
Enzymes [BR:bmc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BAbS19_II07300
Lipid biosynthesis proteins [BR:bmc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BAbS19_II07300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACD74225
UniProt: A0A0F6AV48
Position
2:775141..776247
Genome map
AA seq 368 aa AA seqDB search
MRARHAQGQRPFHDDVHLRHGGPAQRRPGAAARPDGFRRLYARCRGPAQRRYFWNIADPG
WAYGLYYAVTGPLLLGVPTILNEGGFTAENTYDIIERLGVTSLAGSPTAFRLLMAAGPES
AARVKGRLRVASSAGEPLNPEVIRWFDACLGAPIHDHYGQTELGMVVNNHHGLEHPVRQG
SAGYAMPGYRIAVLDEAGKEVGPNEPGILAIDIDNSPLLWFTGYYKKDTPSISGGYYRTG
DTVEFEPDGSISFIGRADDVITSSGYRIGPFDVESALLEHPAVNEAAVVGVPDPQRTEIV
KAFVILAPGFEGTPELAEELALHVKKQLSAHAYPRQIDFVAELPKTPSGKIQRFLLRKAE
VEKQQQQN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcccgtcatgcgcaagggcagcgaccttttcatgatgatgtccacctccggcac
ggcgggcctgcccaaaggcgtcccggtgccgctgcgcgccctgatggctttcggcgccta
tatgcgcgatgccgtgggcctgcgcagcgacgatatttctggaatatcgccgatccgggc
tgggcttatgggctttactatgccgtgacgggtcccctgcttctgggtgtgccgacgatc
ctgaacgaaggcggtttcaccgccgaaaacacctatgacatcatcgaacgcctcggcgtg
acgagccttgcgggctctccgactgccttccgcctgcttatggccgccgggccggaatct
gctgcccgcgtcaagggccgcttgcgcgtggcatccagcgcgggcgagccgctgaacccg
gaagtcattcgctggttcgatgcctgtcttggcgcgccgatccacgatcattacggccag
acggaactgggcatggtggtgaacaaccatcatggattggaacatccggtgcggcagggt
tcggcgggctatgccatgccgggctacaggattgcggttctggatgaagcgggcaaagaa
gtcggtcccaatgaaccgggcattctggccattgatatcgacaattcgccgcttctctgg
ttcaccggctattataaaaaggatacgccctccatctccggcggatattatcgcaccggc
gatacggtggaattcgagccggatgggtctatcagcttcatcggccgcgccgatgacgtc
atcacctcctccggctatcgcatcgggcctttcgatgtggaaagcgcgcttctggaacat
cctgcggtcaacgaggctgcggtggtcggcgttcccgatccgcaacgcaccgaaatcgtg
aaggcctttgtcatcctggcccccggcttcgagggtacgccggaactggcggaagaactg
gcgcttcacgtcaagaaacagctttccgcccatgcctatccgcggcagatcgactttgtg
gcggagcttcccaagacgccgagcggaaaaatacagcgcttcctcctgcgcaaggcggaa
gtcgaaaagcaacagcaacagaattag

DBGET integrated database retrieval system