KEGG   Brucella abortus S19: BAbS19_II07920Help
Entry
BAbS19_II07920    CDS       T00703                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bmc  Brucella abortus S19
Pathway
bmc00051  Fructose and mannose metabolism
bmc00520  Amino sugar and nucleotide sugar metabolism
bmc01100  Metabolic pathways
bmc01110  Biosynthesis of secondary metabolites
bmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BAbS19_II07920
   00520 Amino sugar and nucleotide sugar metabolism
    BAbS19_II07920
Enzymes [BR:bmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BAbS19_II07920
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BAbS19_II07920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 DUF4398
Motif
Other DBs
NCBI-ProteinID: ACD74285
UniProt: A0A0F6AVA7
Position
2:842660..844075
Genome map
AA seq 471 aa AA seqDB search
MSFIPVIISGGSGSRLWPLSRHAHPKPFIKLPDGETLIGKTYARASRLVNAEQILTVTNR
DFLFLTLDAYAAAGAAQMENTFLLEPLGRDTAPAVALAALHAAEAYGPDATLLVMPADHL
IEDEQAFAEAVAKARALAEAGRIVTFGIVPDRPETGFGYIEVQGTDVQRFVEKPDEATAQ
TYVESGRYFWNSGMFCFKALSMIDAMQRYAPQVLAGARAALAQARRGNNGETKTLEIARD
EFAATPAISIDYAVMEKADNMACVPVSCGWSDIGSWAAMADLVTPDENGNRLRGETVLED
TTNSFVLSETRLVSLVGVHDLLVVDTPDALLVAHRDKAQEVRSVFNKLRKQGHEAAKLHR
TAHRPWGTYTVLEEGDGFKIKRIEVKPGRRLSLQAHHHRSEHWIVVSGTAKVTNGDREIL
LTTNQSTYIPCGFRHRLENPGILPLVLIEVQSGEYLGEDDIVRYDDVYGRV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcataccggtaattatcagcgggggatcgggttcaaggctttggccgctttcg
cggcatgcacatccaaaaccctttatcaaactgccggatggcgaaacactcatcggcaag
acctatgcgcgcgcttcgcgccttgtaaacgccgaacagatccttacggttacgaaccgc
gattttcttttcctgacgctcgacgcttatgcggcggcaggtgccgcgcagatggaaaac
actttccttctggagccgcttggccgcgacaccgcgcccgcagtggcgcttgccgccctt
catgccgctgaagcctatgggccggatgccacgcttctggtcatgccggccgatcacctg
atcgaggatgaacaagccttcgcggaagcggttgcgaaagcgcgcgcgcttgccgaggca
gggcgcatcgtcaccttcggcattgtgccggatcggcccgagaccggcttcggctatatc
gaagtgcaaggtacggatgttcagcgatttgtcgaaaagccggatgaggccaccgcccag
acctatgtggaaagcggacgctatttctggaattccggcatgttctgcttcaaggcattg
agcatgatcgacgccatgcagcgttacgcaccgcaggtactggcaggcgctagggctgcc
ctcgcccaggcccggcgtggcaataacggcgagaccaaaacccttgaaatcgccagggac
gagtttgccgcaacgcctgccatttccatcgactacgcagtcatggaaaaggcggacaat
atggcctgcgtgcccgtttcctgcggctggtcggatatcggctcatgggcggcgatggcc
gatctcgtgacacccgatgaaaacggcaatcgcctgcgcggagaaactgttctggaagat
acgaccaacagtttcgtcctttctgaaacccgtctggtgagccttgtcggtgtgcatgat
cttctcgtggttgacacgccggacgcccttctcgtcgctcatcgcgacaaagcgcaggaa
gtacgcagcgttttcaacaaattgcgcaagcaaggtcatgaagctgcaaagctgcaccgc
acagcccatcgcccatggggcacctataccgtgctggaagagggcgacggcttcaagatc
aaacggatcgaggtaaagccagggcggcgcctcagccttcaggcccatcaccaccgctcc
gaacactggatcgtggtgtccggcacggcaaaggtgacgaatggcgaccgggaaatcctg
ctcaccaccaatcagtcaacctatattccctgcggtttccgccaccggttggaaaatccc
ggtattttgcccctcgtcctgatcgaggtgcagagcggcgaatatctcggtgaagacgac
atcgtgcgctatgacgatgtttacggacgcgtttga

DBGET integrated database retrieval system