KEGG   Brucella abortus S19: BAbS19_II09190Help
Entry
BAbS19_II09190    CDS       T00703                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bmc  Brucella abortus S19
Pathway
bmc00300  Lysine biosynthesis
bmc01100  Metabolic pathways
bmc01120  Microbial metabolism in diverse environments
bmc01230  Biosynthesis of amino acids
Module
bmc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bmc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAbS19_II09190
Enzymes [BR:bmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BAbS19_II09190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACD74404
UniProt: B2SC17
Position
2:972290..973477
Genome map
AA seq 395 aa AA seqDB search
MTLPVNPVDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYA
RKSGNGPHLMFAGHTDVVPPGDEKDWKHPPFAAEIEDGVMYGRGAVDMKGGIACFVAAVA
RHIEKHGNIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDM
IKIGRRGSLSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLE
VTTIDVGNKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPI
KYELTWRERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEF
GLTGQTMHMVDERVALADLEGLTQIYERFIADFFG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccctacctgtcaatcccgtcgataatcttgccgccctcatccgctgcccatccgtc
acacccgccgaagggggggcgctgactgcactggaaaaaatgctgaagctcatgggcttt
tcagcaaaccgccccgttttcagcgatgacaacacgcccgatattgaaaatctctatgcc
cgcaaatccggcaatgggccacatctgatgttcgcaggccacaccgatgtcgtgccgccc
ggcgatgaaaaggactggaagcacccgccctttgccgcagaaatcgaggacggcgtgatg
tatggccgtggcgcggtggacatgaaaggcggcatcgcctgtttcgtggccgcggttgcc
cgccacatcgaaaagcatggcaacatcaagggcagcatttcctttctcatcaccggcgat
gaggaaggcccggccgtcaacggcacggtgaaactgctcgaatgggcaaaacaacgcggc
gaaagctgggatgcatcgatcgtcggtgaaccaaccaacccgaacgcgcttggcgacatg
atcaagatcgggcggcgcggttcgctctccggcacgattaccgttcatggcgtgcagggc
catgccgcctatccgcatctggctgaaaatccggtccgtggcatcgtcacgctggttgac
agcctgctttaccccgccttcgatgaaggcacggcaaatttccaggccagcaatctggaa
gtcaccaccattgatgtgggcaacaaggccaccaatgtcatcccgaacaaggcgaccgcc
tcgttcaacatccgcttcaatgacacatggacggccgaaagccttcaagcggaaatcatc
tcccggctggaaagggccgcgcgcgacaaccgcctgcgccaggggcgcgaaacgccgatc
aaatacgaactgacctggcgtgagcggccaagccatgtcttcctcacccatgatgaaaaa
ctgatcggcacgctcaccgcatcggtagaggccgtaaccggcaaacgcccggaactgtcc
acttcaggcggcacgtccgatgcccgcttcatcaaggattattgcccggtggtggagttt
ggccttacgggccagaccatgcatatggttgatgagcgcgtggcccttgccgacctcgaa
ggcctgacgcagatttatgaacgcttcatcgcggatttctttgggtaa

DBGET integrated database retrieval system