KEGG   Bacillus megaterium DSM 319: BMD_0019Help
Entry
BMD_0019          CDS       T01219                                 

Gene name
dck
Definition
(GenBank) deoxyadenosine/deoxycytidine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00230  Purine metabolism
bmd00240  Pyrimidine metabolism
bmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BMD_0019 (dck)
   00240 Pyrimidine metabolism
    BMD_0019 (dck)
Enzymes [BR:bmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BMD_0019 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BMD_0019 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_33 TsaE RsgA_GTPase RNA_helicase AAA_25 ABC_tran AAA_22 ATP_bind_1 ParA AAA_28 AAA_16 AAA_29 NB-ARC NACHT AAA_5 CbiA
Motif
Other DBs
NCBI-ProteinID: ADF36980
UniProt: D5D929
Position
complement(21927..22607)
Genome map
AA seq 226 aa AA seqDB search
MVNLRSKYNIPNDAVLTIAGTVGVGKSTMTQSLADALQFRTSFEKVDSNPYLDKFYGDFE
RWSFHLQVYFLAERFKEQKKIFEYGGGFIQDRSIYEDTGIFAKMHFEKGTMSKVDYQTYT
SLFDAMVMTPYFPHPDLLIYLEGSFEDIVDRIQERGRPMEQQTPLDYWKEMHARYEDWIN
NFTACPILRLDIREYDLIKDPDSIESIVEKVARFLQHNEKLKRRHL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacttacgatcgaaatacaacattcctaatgatgctgtgttgacgatagcgggt
acagttggagttgggaaatctacaatgactcaatcattggctgatgccctccaatttcgc
acatcgtttgaaaaagtagattccaacccttacctggacaaattttatggagattttgaa
cgttggagcttccacctacaggtatattttctagcggaacgctttaaagaacaaaagaaa
attttcgagtatggcggcggcttcatccaagacagatccatttacgaagataccggtatc
tttgctaagatgcattttgaaaaaggaacgatgtctaaagtagactatcaaacatataca
agcttgttcgatgcaatggttatgactccatatttccctcatccggatctgctcatttat
ttggaaggcagcttcgaagatattgtagatcgcattcaagaaagagggcgaccaatggaa
cagcaaacgcctcttgattattggaaagagatgcacgcccgatacgaagactggattaat
aactttacggcttgccctattcttcgtttagatattagagaatacgaccttatcaaggat
cctgattcaattgaatcaattgttgaaaaagtggctcgctttttacaacataatgaaaag
ttaaaacgtcgtcatctataa

DBGET integrated database retrieval system